Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RNASE2 protein

This Human RNASE2 protein spans the amino acid sequence from region 28-161aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RNASE2 EDN RNS2

UniProt

P10153

Expression Region

28-161aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 28-161aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KPPQFTWAQWFETQHINMTSQQCTNAMQVINNYQRRCKNQNTFLLTTFANVVNVCGNPNMTCPSNKTRKNCHHSGSQVPLIHCNLTTPSPQNISNCRYAQTPANMFYIVACDNRDQRRDPPQYPVVPVHLDRII

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SETP1 AAV Vector (Human) (CMV)
43535101 1 µg

SETP1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Wnt-5b (G-4) HRP
sc-376249 HRP 200 µg/mL

Wnt-5b (G-4) HRP

Sign In for Pricing
View Details
IRX3 (Iroquois Homeobox 3, IRX-1) (MaxLight 550)
247727-ML550 100 µL

IRX3 (Iroquois Homeobox 3, IRX-1) (MaxLight 550)

Sign In for Pricing
View Details
Anti-Solanum lycopersicum (Tomato) RALF1 Antibody Fluoro647 Conjugated
DZ41696-Fluoro647 200 µL/Vial

Anti-Solanum lycopersicum (Tomato) RALF1 Antibody Fluoro647 Conjugated

Sign In for Pricing
View Details
Fundulus heteroclitus Serine/threonine-protein kinase Rabbit Polyclonal Antibody (HRP)
orb2666783 200 µL

Fundulus heteroclitus Serine/threonine-protein kinase Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
FHIT Peptide - middle region
orb2010704 100 µg

FHIT Peptide - middle region

Sign In for Pricing
View Details