Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FHIT Peptide - middle region

FHIT Peptide - middle region

Product Specifications

Product Name Alternative

AP3Aase, FRA3B

UniProt

P49789

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FHIT Rabbit Polyclonal Antibody (orb581286) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002003

Preservative

Lyophilized powder

AA Sequence

VHVLPRKAGDFHRNDSIYEELQKHDKEDFPASWRSEEEMAAEAAALRVYF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LOC500684 Protein Vector (Rat) (pPM-C-HA)
27297026 500 ng

LOC500684 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
S100A3 Human Gene Knockout Kit (CRISPR)
KN202117 1 Kit

S100A3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
anti-GAPDH-SO3
LF-PA0006 100 ul

anti-GAPDH-SO3

Sign In for Pricing
View Details
PIWIL1 Recombinant Antibody, APC Conjugated
bsm-61743R-APC-01 20 µL

PIWIL1 Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details
PIWIL1 Recombinant Antibody, APC Conjugated
bsm-61743R-APC-02 100 µL

PIWIL1 Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details
CD300e Polyclonal Antibody
E046816 100 µg -100 µL

CD300e Polyclonal Antibody

Sign In for Pricing
View Details