Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NDUFA3 protein

This Human NDUFA3 protein spans the amino acid sequence from region 2-84aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NDUFA3

UniProt

O95167

Expression Region

2-84aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of GST-tag and expression region is 2-84aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AARVGAFLKNAWDKEPVLVVSFVVGGLAVILPPLSPYFKYSVMINKATPYNYPVPVRDDGNMPDVPSHPQDPQGPSLEWLKKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal PADI4 Antibody (OTI4H5) [mFluor Violet 500 SE]
NBP2-73226MFV500 0.1 mL

Mouse Monoclonal PADI4 Antibody (OTI4H5) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Vertical freeze dryer; Desktop freeze dryer
E1684 1 Unit

Vertical freeze dryer; Desktop freeze dryer

Sign In for Pricing
View Details
Mouse Monoclonal Galectin-9 Antibody (OTI1D12) [Janelia Fluor 646]
NBP2-71132JF646 0.1 mL

Mouse Monoclonal Galectin-9 Antibody (OTI1D12) [Janelia Fluor 646]

Sign In for Pricing
View Details
HOMER1 Antibody, Biotin conjugated
A39412-50UG 50 µg

HOMER1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
FAP targeting peptide-PEG2 conjugate
HY-P10946 1 Each

FAP targeting peptide-PEG2 conjugate

Sign In for Pricing
View Details
IgG Antibody
OARA04443-50MG 50 mg

IgG Antibody

Sign In for Pricing
View Details