Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MYLPF protein

This Human MYLPF protein spans the amino acid sequence from region 2-169aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MYLPF

UniProt

Q96A32

Expression Region

2-169aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

APKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRLNVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFLEELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SARS-CoV-2 S RBD (V503F, HEK293, His)
HY-P76628 1 Each

SARS-CoV-2 S RBD (V503F, HEK293, His)

Sign In for Pricing
View Details
CD20 Rabbit pAb (APR24093N)
APR24093N-01 50 µL

CD20 Rabbit pAb (APR24093N)

Sign In for Pricing
View Details
CD20 Rabbit pAb (APR24093N)
APR24093N-02 100 µL

CD20 Rabbit pAb (APR24093N)

Sign In for Pricing
View Details
CD20 Rabbit pAb (APR24093N)
APR24093N-03 200 µL

CD20 Rabbit pAb (APR24093N)

Sign In for Pricing
View Details
2,6-Dimethylquinolin-4-amine (hydrochloride)
OR1076955-01 100 mg

2,6-Dimethylquinolin-4-amine (hydrochloride)

Sign In for Pricing
View Details
2,6-Dimethylquinolin-4-amine (hydrochloride)
OR1076955-02 250 mg

2,6-Dimethylquinolin-4-amine (hydrochloride)

Sign In for Pricing
View Details