Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD20 Rabbit pAb (APR24093N)

Product Specifications

Background

This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This gene encodes a B-lymphocyte surface molecule which plays a role in the development and differentiation of B-cells into plasma cells. This family member is localized to 11q12, among a cluster of family members. Alternative splicing of this gene results in two transcript variants which encode the same protein.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality CD20 Rabbit pAb (APR24093N) .

Synonyms

MS4A1; B1; Bp35; CD20; CVID5; LEU-16; MS4A2; S7

Gene ID

931

UniProt

P11836

Cellular Locus

Cell membrane, Lipid-anchor, Multi-pass membrane protein

Applications

IHC (Mus musculus, Homo sapiens) IF (Mus musculus)

Dilution

WB 1:500 - 1:2000 IF 1:50 - 1:200

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 14kDa/33kDa Observed MW: 33-37kd

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=931

Uniprot URL

https://www.uniprot.org/uniprot/P11836

AA Sequence

IAGIVENEWKRTCSRPKSNIVLLSAEEKKEQTIEIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFPEPPQDQESSPIENDSSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human BD4 (DEFB104A) activation kit by CRISPRa
GA115375 1 Kit

Human BD4 (DEFB104A) activation kit by CRISPRa

Sign In for Pricing
View Details
Embutramide
TRC-E521010-25MG 25 mg

Embutramide

Sign In for Pricing
View Details
EFNB1 (Ab-317) Antibody
8B0916-AAT 50 µg

EFNB1 (Ab-317) Antibody

Sign In for Pricing
View Details
TMPRSS5 Human Gene Knockout Kit (CRISPR)
KN423774 1 Kit

TMPRSS5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MCM3 Human Gene Knockout Kit (CRISPR)
KN400208 1 Kit

MCM3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: transverse
CS640598 5x 5 µm

Frozen Tissue Sections, Colon: transverse

Sign In for Pricing
View Details