Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TMX3 protein

This Human TMX3 protein spans the amino acid sequence from region 25-195aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TMX3

UniProt

Q96JJ7

Expression Region

25-195aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KGFVEDLDESFKENRNDDIWLVDFYAPWCGHCKKLEPIWNEVGLEMKSIGSPVKVGKMDATSYSSIASEFGVRGYPTIKLLKGDLAYNYRGPRTKDDIIEFAHRVSGALIRPLPSQQMFEHMQKRHRVFFVYVGGESPLKEKYIDAASELIVYTYFFSASEEVVPEVIFKI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Jar, Wide Mouth, 180mL (6oz), PP, 70mm O
6383 432/CS

Jar, Wide Mouth, 180mL (6oz), PP, 70mm O

Sign In for Pricing
View Details
HDAC2 (full-length) (human), (recombinant) (His-tag)
BML-SE533-0050 50 µg

HDAC2 (full-length) (human), (recombinant) (His-tag)

Sign In for Pricing
View Details
GJB5 (Gap Junction beta-5 Protein, Connexin-31.1, Cx31.1) (HRP)
MBS6379817-01 0.1 mL

GJB5 (Gap Junction beta-5 Protein, Connexin-31.1, Cx31.1) (HRP)

Sign In for Pricing
View Details
GJB5 (Gap Junction beta-5 Protein, Connexin-31.1, Cx31.1) (HRP)
MBS6379817-02 5x 0.1 mL

GJB5 (Gap Junction beta-5 Protein, Connexin-31.1, Cx31.1) (HRP)

Sign In for Pricing
View Details
PRLHR/GPR10 Antibody
orb1534032 50 µg

PRLHR/GPR10 Antibody

Sign In for Pricing
View Details
Anti-Sam68/KHDRBS1 Antibody Picoband
MBS1758227-01 0.01 mg

Anti-Sam68/KHDRBS1 Antibody Picoband

Sign In for Pricing
View Details