Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RAB3C protein

This Human RAB3C protein spans the amino acid sequence from region 1-227aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RAB3C

UniProt

Q96E17

Expression Region

1-227aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MRHEAPMQMASAQDARYGQKDSSDQNFDYMFKLLIIGNSSVGKTSFLFRYADDSFTSAFVSTVGIDFKVKTVFKNEKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVILVGNKCDMEDERVISTERGQHLGEQLGFEFFETSAKDNINVKQTFERLVDIICDKMSESLETDPAITAAKQNTRLKETPPPPQPNCAC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PBST with Kathon 10X with 0.5% Tween 20, pH 7.6
40120185-2 2x1 L

PBST with Kathon 10X with 0.5% Tween 20, pH 7.6

Sign In for Pricing
View Details
SMYD1 (A-12) Alexa Fluor® 488
sc-514804 AF488 200 µg/mL

SMYD1 (A-12) Alexa Fluor® 488

Sign In for Pricing
View Details
(25S) -delta7-Dafachronic acid
sc-364091 100 µg

(25S) -delta7-Dafachronic acid

Sign In for Pricing
View Details
Wnt6 Peptide - middle region
orb2004409 100 µg

Wnt6 Peptide - middle region

Sign In for Pricing
View Details
Recombinant Human CEP170B
P7059-01 50 µg

Recombinant Human CEP170B

Sign In for Pricing
View Details
Recombinant Human CEP170B
P7059-02 200 µg

Recombinant Human CEP170B

Sign In for Pricing
View Details