Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Wnt6 Peptide - middle region

Wnt6 Peptide - middle region

Product Specifications

UniProt

D4A3W9

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Wnt6 Rabbit Polyclonal Antibody (orb579861) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001101696

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PGPTGSPDASAAWEWGGCGDDVDFGDEKSRLFMDAQHKRGRGDIRALVQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UPRT Mouse Monoclonal Antibody [Clone ID: OTI1E11]
TA506868 100 µL

UPRT Mouse Monoclonal Antibody [Clone ID: OTI1E11]

Sign In for Pricing
View Details
Rat Acrosin (ACR) ELISA Kit
MBS280891-01 48 Tests

Rat Acrosin (ACR) ELISA Kit

Sign In for Pricing
View Details
Rat Acrosin (ACR) ELISA Kit
MBS280891-02 96 Tests

Rat Acrosin (ACR) ELISA Kit

Sign In for Pricing
View Details
Rat Acrosin (ACR) ELISA Kit
MBS280891-03 5x 96 Tests

Rat Acrosin (ACR) ELISA Kit

Sign In for Pricing
View Details
Rat Acrosin (ACR) ELISA Kit
MBS280891-04 10x 96 Tests

Rat Acrosin (ACR) ELISA Kit

Sign In for Pricing
View Details
Tadnersen
MBS5800086 Inquire

Tadnersen

Sign In for Pricing
View Details