Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PLEKHB2 protein

This Human PLEKHB2 protein spans the amino acid sequence from region 1-222aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PLEKHB2

UniProt

Q96CS7

Expression Region

1-222aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAFVKSGWLLRQSTILKRWKKNWFDLWSDGHLIYYDDQTRQNIEDKVHMPMDCINIRTGQECRDTQPPDGKSKDCMLQIVCRDGKTISLCAESTDDCLAWKFTLQDSRTNTAYVGSAVMTDETSVVSSPPPYTAYAAPAPEQAYGYGPYGGAYPPGTQVVYAANGQAYAVPYQYPYAGLYGQQPANQVIIRERYRDNDSDLALGMLAGAATGMALGSLFWVF

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse CD23/Fc epsilon RII Alexa Fluor 700 Antibody
FAB6900N-100UG 100 µg

Mouse CD23/Fc epsilon RII Alexa Fluor 700 Antibody

Sign In for Pricing
View Details
SHOC2
CSB-CL891468HU 10 μg Plasmid + 200 μL Glycerol

SHOC2

Sign In for Pricing
View Details
Chicken Collectin 10 (COLEC10) ELISA Kit
abx355838-01 96 Tests

Chicken Collectin 10 (COLEC10) ELISA Kit

Sign In for Pricing
View Details
Chicken Collectin 10 (COLEC10) ELISA Kit
abx355838-02 5x 96 Tests

Chicken Collectin 10 (COLEC10) ELISA Kit

Sign In for Pricing
View Details
Chicken Collectin 10 (COLEC10) ELISA Kit
abx355838-03 10x 96 Tests

Chicken Collectin 10 (COLEC10) ELISA Kit

Sign In for Pricing
View Details
MAPK1 Rabbit Polyclonal Antibody (Biotin)
orb2099443 100 µL

MAPK1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details