Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPK1 Rabbit Polyclonal Antibody (Biotin)

MAPK1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ERK, p38, p40, p41, ERK2, ERT1, NS13, ERK-2, MAPK2, PRKM1, PRKM2, P42MAPK, p41mapk, p42-MAPK

UniProt

P28482

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human MAPK1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

41kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_620407

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

DUSP8, CT (Dual Specificity Protein Phosphatase 8, Dual Specificity Protein Phosphatase hVH-5, VH5) (AP)
MBS6473199-01 0.2 mL

DUSP8, CT (Dual Specificity Protein Phosphatase 8, Dual Specificity Protein Phosphatase hVH-5, VH5) (AP)

Sign In for Pricing
View Details
DUSP8, CT (Dual Specificity Protein Phosphatase 8, Dual Specificity Protein Phosphatase hVH-5, VH5) (AP)
MBS6473199-02 5x 0.2 mL

DUSP8, CT (Dual Specificity Protein Phosphatase 8, Dual Specificity Protein Phosphatase hVH-5, VH5) (AP)

Sign In for Pricing
View Details
TMEM219 (NM_194280) Human Tagged ORF Clone Lentiviral Particle
RC207974L3V 200 µL

TMEM219 (NM_194280) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse Monoclonal Complement C3a Antibody (2B5) [Janelia Fluor 549]
NBP3-17997JF549 0.1 mL

Mouse Monoclonal Complement C3a Antibody (2B5) [Janelia Fluor 549]

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus Uridylate kinase (pyrH)
MBS1468957-01 0.02 mg (E-Coli)

Recombinant Prochlorococcus marinus Uridylate kinase (pyrH)

Sign In for Pricing
View Details
Recombinant Prochlorococcus marinus Uridylate kinase (pyrH)
MBS1468957-02 0.1 mg (E-Coli)

Recombinant Prochlorococcus marinus Uridylate kinase (pyrH)

Sign In for Pricing
View Details