Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Dog L4 protein

This Dog L4 protein spans the amino acid sequence from region 25-132aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

L4

UniProt

O77762

Expression Region

25-132aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Canis lupus familiaris (Dog) (Canis familiaris)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-tag and expression region is 25-132aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HNFNITIKEIIKMLNILTARNDSCMELTVKDVFTAPKNTSDKEIFCRAATVLRQIYTHNCSNRYLRGLYRNLSSMANKTCSMNEIKKSTLKDFLERLKVIMQKKYYRH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal AHNAK Antibody (EM-09) [Janelia Fluor 549]
NBP2-62204JF549 0.1 mL

Mouse Monoclonal AHNAK Antibody (EM-09) [Janelia Fluor 549]

Sign In for Pricing
View Details
Recombinant Human MLX-interacting protein Protein, His-SUMO, E.coli-10ug
QP8054-ec-10ug 10ug

Recombinant Human MLX-interacting protein Protein, His-SUMO, E.coli-10ug

Sign In for Pricing
View Details
GLYR1-set siRNA/shRNA/RNAi Lentivector (Human)
21673091 4x 500 ng

GLYR1-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
Pam16 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
35974114 3x 1.0 µg

Pam16 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Cattle PⅠNP (Procollagen Ⅰ N-Terminal Propeptide) ELISA Kit
EK248117 96 Well

Cattle PⅠNP (Procollagen Ⅰ N-Terminal Propeptide) ELISA Kit

Sign In for Pricing
View Details
RpII215 Recombinant Protein
OPCA03461-100UG 100 µg

RpII215 Recombinant Protein

Sign In for Pricing
View Details