Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RpII215 Recombinant Protein

Product Specifications

CAS Number

9000-83-3

Gene Name

RNA polymerase II 215kD subunit

Gene Aliases

5;8WG16; alphaPol IIo[ser2]; CG1554; CG1554-PA; CTD; DmCTD; Dmel\CG1554; Dmel_CG1554; DNA-directed RNA polymerase III largest subunit; dRPB1; H5; II; IIo; l (1) 10Ca; l (1) DC912; l (1) DF912; l (1) G0040; l (1) L5; L5; POL; Pol II; Pol II CTD; Pol II large subunit; Pol II large subunit CTD; Pol II Ser5P; Pol II[ser2]; Pol II0[ser2]; Pol II0[ser5]; Pol IIa; Pol IIo; Pol IIo[Ser2]; Pol IIo[ser5]; PolII; Pol-II; PolIIa; Pol-IIa; PolIIo; PolIIo[ser2]; PolIIo[ser5]; Poll II; polymerase II CTD; RNA Pol II; RNA Pol II CTD; RNA pol IIo; RNA PolI 215; RNA PolII; RNA polymerase II; RNA polymerase II 215kD subunit; RNA polymerase II large subunit; RNA polymerase II largest subunit; RNA polymerase IIo; RNA polymeraseII-215 kd subunit; RNAP; RNAP II; RNAP II LS; RNAPII; RNAPII0; RNApol; RNA-Pol; RNApol2; RNApolII; RNA-PolII; RNA-polymerase II; Rpb1; RpII; rpII1; RPII215; RpII215-PA; Rpll215; Ser5-P Pol II; Ubl; Ultrabithorax-like.

Gene ID

32100

Accession Number

NP_511124.1

Reactivity

Drosophila melanogaster

Target

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Largest and catalytic component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Forms the polymerase active center together with the second largest subunit. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB1 is part of the core element with the central large cleft, the clamp element that moves to open and close the cleft and the jaws that are thought to grab the incoming DNA template. At the start of transcription, a single-stranded DNA template strand of the promoter is positioned within the central active site cleft of Pol II. A bridging helix emanates from RPB1 and crosses the cleft near the catalytic site and is thought to promote translocation of Pol II by acting as a ratchet that moves the RNA-DNA hybrid through the active site by switching from straight to bent conformations at each step of nucleotide addition. During transcription elongation, Pol II moves on the template as the transcript elongates. Elongation is influenced by the phosphorylation status of the C-terminal domain (CTD) of Pol II largest subunit (RPB1), which serves as a platform for assembly of factors that regulate transcription initiation, elongation, termination and mRNA processing (By similarity) .

Type

Protein

Source

Yeast

Sequence

YSPTSPNYTASSPGGASPNYSPSSPNYSPTSPLYASPRYASTTPNFNPQSTGYSPSSSGYSPTSPVYSPTVQFQSSPSFAGSGSNIYSPGNAYSPSSSNYSPNSPSYSPTSPSYSPSSPSYSPTSPCYSPTSPSYSPTSPNYTPVTPSYSPTSPNYSASPQYSPASPAYSQTGVKYSPTSPTYSPPSPSYDGSPGSPQYTPGSPQYSPASPKYSPTSPLYSPSSPQHSPSNQYSPTGSTYSATSPRYSPNMSIYSPSSTKYSPTSPTYTPTARNYSPTSPMYSPTAPSHYSPTSPAYSPSSPT

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

33.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

RpII215

Host or Source

Drosophila melanogaster

Protein Name

DNA-directed RNA polymerase II subunit RPB1

Gene Name URL

RpII215

Nucleotide Accession Number

NM_078569.3

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cinnamyl acetate
M20312-01 1 g

Cinnamyl acetate

Sign In for Pricing
View Details
Cinnamyl acetate
M20312-02 500 mg

Cinnamyl acetate

Sign In for Pricing
View Details
Cinnamyl acetate
M20312-03 100 mg

Cinnamyl acetate

Sign In for Pricing
View Details
Cinnamyl acetate
M20312-04 200 mg

Cinnamyl acetate

Sign In for Pricing
View Details
Cinnamyl acetate
M20312-05 1 mL x 10 mM in DMSO

Cinnamyl acetate

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Uncharacterized membrane protein YOR034C-A (YOR034C-A)
MBS7039932-01 0.02 mg

Recombinant Saccharomyces cerevisiae Uncharacterized membrane protein YOR034C-A (YOR034C-A)

Sign In for Pricing
View Details