Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rabbit Il17a protein

This Rabbit Il17a protein spans the amino acid sequence from region 21-153aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Il17a Ctla8 Il17

UniProt

G1SLF2

Expression Region

21-153aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Oryctolagus cuniculus (Rabbit)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of GST-tag and expression region is 21-153aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VKNGIAMPRNPGCPNAEDKNFPQNVKVSLNILNKSVNSRRPSDYYNRSTSPWTLHRNEDRERYPSVIWEAKCRHLGCVNAEGNEDHHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIIHHMA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant human WDR5 protein
ATGP0632-500 500 µg

Recombinant human WDR5 protein

Sign In for Pricing
View Details
Human lung cancer Marker (LCM) ELISA Kit
EIA05994h 1 Kit

Human lung cancer Marker (LCM) ELISA Kit

Sign In for Pricing
View Details
Anti-NALP12  (4B9)
YF-MA19647 100 ug

Anti-NALP12 (4B9)

Sign In for Pricing
View Details
EGLN2, NT (EGLN2, EIT6, Egl nine homolog 2, Estrogen-induced tag 6, HPH-3, Hypoxia-inducible factor prolyl hydroxylase 1, Prolyl hydroxylase domain-containing protein 1) (Biotin) discontinued
034971-Biotin 200 µL

EGLN2, NT (EGLN2, EIT6, Egl nine homolog 2, Estrogen-induced tag 6, HPH-3, Hypoxia-inducible factor prolyl hydroxylase 1, Prolyl hydroxylase domain-containing protein 1) (Biotin) discontinued

Sign In for Pricing
View Details
TET3 Rabbit mAb
MBS9147666-01 0.02 mL

TET3 Rabbit mAb

Sign In for Pricing
View Details
TET3 Rabbit mAb
MBS9147666-02 0.1 mL

TET3 Rabbit mAb

Sign In for Pricing
View Details