Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine LAP3 protein

This Bovine LAP3 protein spans the amino acid sequence from region 25-64aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

LAP3

UniProt

P00727

Expression Region

25-64aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Bos taurus (Bovine)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PGPAAADMTKGLVLGIYSKEKEEDEPQFTSAGENFNKLVS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C330007P06Rik shRNA Plasmid (m)
sc-141898-SH 20 µg

C330007P06Rik shRNA Plasmid (m)

Sign In for Pricing
View Details
Human FAM162A Pre-designed siRNA Set B
SI005334B 1 Each

Human FAM162A Pre-designed siRNA Set B

Sign In for Pricing
View Details
Atg9b HDR Plasmid (m)
sc-431901-HDR 20 µg

Atg9b HDR Plasmid (m)

Sign In for Pricing
View Details
Histone H2A.X (Phospho Thr120) rabbit pAb
ES20579-01 50 µL

Histone H2A.X (Phospho Thr120) rabbit pAb

Sign In for Pricing
View Details
Histone H2A.X (Phospho Thr120) rabbit pAb
ES20579-02 100 µL

Histone H2A.X (Phospho Thr120) rabbit pAb

Sign In for Pricing
View Details
Frozen Tissue Sections, Breast
CS628647 5x 5 µm

Frozen Tissue Sections, Breast

Sign In for Pricing
View Details