Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Bovine S protein

This Bovine S protein spans the amino acid sequence from region 326-540aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

S, Spike glycoprotein, S glycoprotein, E2, Peplomer protein

UniProt

P25194

Expression Region

326-540aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Bovine coronavirus (strain vaccine) (BCoV) (BCV)

Field of Research

Epigenetics, Infectious Diseases, Non-Animal

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

27.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PNLPDCNIEAWLNDKSVPSPLNWERKTFSNCNFNMSSLMSFIQADSFTCNNIEAAKIYGMCFSSITIDKFAIPNGRKVDLQLGNLGYLQSFNYRIDTTAASCQLYYNLPAANVSVSRFNPSTWNRRFGFTEQSVFKPQPVGVFTHHDVVYAQHCFKAPTNFCPCKLDGSLCVGNGPGIDAGYKNSGIGTCPAGTNYLTCHNAAQCDCLCTPDPIT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Colon: left
CS622366 5x 5 µm

Frozen Tissue Sections, Colon: left

Sign In for Pricing
View Details
FOXP1 Rabbit Polyclonal Antibody
TA376344 100 µL

FOXP1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Zfp536 Mouse Gene Knockout Kit (CRISPR)
KN519874 1 Kit

Zfp536 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD47 Mouse Monoclonal Antibody [Clone ID: OTI6A2]
CF813323 100 µg

CD47 Mouse Monoclonal Antibody [Clone ID: OTI6A2]

Sign In for Pricing
View Details
Von Willebrand Factor Recombinant Rabbit Monoclonal Antibody [PSH07-45]
HA722833 100 µL

Von Willebrand Factor Recombinant Rabbit Monoclonal Antibody [PSH07-45]

Sign In for Pricing
View Details
Ankrd24 Mouse Gene Knockout Kit (CRISPR)
KN501275 1 Kit

Ankrd24 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details