Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human COX4I1 protein

This Human COX4I1 protein spans the amino acid sequence from region 23-169aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

COX4I1

UniProt

P13073

Expression Region

23-169aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of His-SUMO-tag and expression region is 23-169aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AHESVVKSEDFSLPAYMDRRDHPLPEVAHVKHLSASQKALKEKEKASWSSLSMDEKVELYRIKFKESFAEMNRGSNEWKTVVGGAMFFIGFTALVIMWQKHYVYGPLPQSFDKEWVAKQTKRMLDMKVNPIQGLASKWDYEKNEWKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR5BN2P ORF Vector (Human) (pORF)
ORF026978 1.0 µg DNA

OR5BN2P ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Neurogenin2, CT (NEUROG2, ATOH4, BHLHA8, NGN2, Neurogenin-2, Class A basic helix-loop-helix protein 8, Protein atonal homolog 4) (MaxLight 650) discontinued
038916-ML650 100 µL

Neurogenin2, CT (NEUROG2, ATOH4, BHLHA8, NGN2, Neurogenin-2, Class A basic helix-loop-helix protein 8, Protein atonal homolog 4) (MaxLight 650) discontinued

Sign In for Pricing
View Details
MRPS25 Rabbit Polyclonal Antibody (Biotin)
orb2085850 100 µL

MRPS25 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Recombinant Human Protein POLR1D, isoform 2 (RPC22)
orb3009410-01 20 µg

Recombinant Human Protein POLR1D, isoform 2 (RPC22)

Sign In for Pricing
View Details
Recombinant Human Protein POLR1D, isoform 2 (RPC22)
orb3009410-02 100 µg

Recombinant Human Protein POLR1D, isoform 2 (RPC22)

Sign In for Pricing
View Details
Recombinant Human Protein POLR1D, isoform 2 (RPC22)
orb3009410-03 1 mg

Recombinant Human Protein POLR1D, isoform 2 (RPC22)

Sign In for Pricing
View Details