Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein POLR1D, isoform 2 (RPC22)

This Recombinant Human Protein POLR1D, isoform 2 (RPC22) spans the amino acid sequence from region 1-122. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein POLR1D, isoform 2 POLR1D

UniProt

P0DPB5

Expression Region

1-122

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MEEDQELERKAIEELLKEAKRGKTRAETMGPMGWMKCPLASTNKRFLINTIKNTLPSHKEQDHEQKEGDKEPAKSQAQKEENPKKHRSHPYKHSFRARGSASYSPPRKRSSQDKYEKRSNRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant TNS4 Antibody
RC-5422-01 50 μL

Recombinant TNS4 Antibody

Sign In for Pricing
View Details
Recombinant TNS4 Antibody
RC-5422-02 100 µL

Recombinant TNS4 Antibody

Sign In for Pricing
View Details
Recombinant TNS4 Antibody
RC-5422-03 1 mL

Recombinant TNS4 Antibody

Sign In for Pricing
View Details
Cordycepin-13C5
TRC-C685802-2.5MG 2.5 mg

Cordycepin-13C5

Sign In for Pricing
View Details
Phenaglycodol
TRC-P294725-5MG 5 mg

Phenaglycodol

Sign In for Pricing
View Details
Pure Lens culinaris Lectin (Lentil) -LcH-
L-1401-10 10 mg

Pure Lens culinaris Lectin (Lentil) -LcH-

Sign In for Pricing
View Details