Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TMEM14B protein

This Human TMEM14B protein spans the amino acid sequence from region 1-114aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TMEM14B

UniProt

Q9NUH8

Expression Region

1-114aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full length of GST-tag and expression region is 1-114aa

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEKPLFPLVPLHWFGFGYTALVVSGGIVGYVKTGSVPSLAAGLLFGSLAGLGAYQLYQDPRNVWGFLAATSVTFVGVMGMRSYYYGKFMPVGLIAGASLLMAAKVGVRMLMTSD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human 5'-nucleotidase/CD73/NT5E Protein (His Tag)
B2019130 10 µg

Recombinant Human 5'-nucleotidase/CD73/NT5E Protein (His Tag)

Sign In for Pricing
View Details
Cathepsin D Rabbit Polyclonal Antibody
MBS9512402-01 0.05 mL

Cathepsin D Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cathepsin D Rabbit Polyclonal Antibody
MBS9512402-02 0.1 mL

Cathepsin D Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cathepsin D Rabbit Polyclonal Antibody
MBS9512402-03 5x 0.1 mL

Cathepsin D Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LOC101928751 (BC031108) Human Untagged Clone
SC126044 10 µg

LOC101928751 (BC031108) Human Untagged Clone

Sign In for Pricing
View Details
UFC1 Antibody
43612 100 µL

UFC1 Antibody

Sign In for Pricing
View Details