Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse MMP14 (Matrix Metalloproteinase 14) Microsample ELISA Kit

Mouse MMP14 (Matrix Metalloproteinase 14) Microsample ELISA Kit

Product Specifications

Product Name Alternative

MMP-X1; MT1-MMP; MTMMP1; Membrane Inserted; Membrane-type matrix metalloproteinase 1; Membrane-type-1 matrix metalloproteinase

UniProt

P53690

Reactivity

Mouse

Field of Research

Musculoskeletal & Connective Tissue Research

Assay Type

Sandwich

Assay Performance Time

3.5h

Sample Type

Serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids

Sensitivity

0.11 ng/mL

Notes

For research use only.

Applications Notes

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Mouse MMP14. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Mouse MMP14. Next, Avidin conjugated to Horseradish Peroxidase (HRP) is added to each microplate well and incubated. After TMB substrate solution is added, only those wells that contain Mouse MMP14, biotin-conjugated antibody and enzyme-conjugated Avidin will exhibit a change in color. The enzyme-substrate reaction is terminated by the addition of sulphuric acid solution and the color change is measured spectrophotometrically at a wavelength of 450nm ± 10nm. The concentration of Mouse MMP14 in the samples is then determined by comparing the OD of the samples to the standard curve.

Dynamic Range

0.32-20 ng/mL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW
MBS5818163 Inquire

VSGLNPSLWSIFGLQFILLWLVSGSRHYLW

Sign In for Pricing
View Details
Recombinant Human ERN2 (IRE2) (N-GST tag)
Z500136 10 µg

Recombinant Human ERN2 (IRE2) (N-GST tag)

Sign In for Pricing
View Details
Rrs1 (NM_021511) Mouse Tagged ORF Clone Lentiviral Particle
MR205622L4V 200 µL

Rrs1 (NM_021511) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
LIMK1 (LIM Domain Kinase 1, LIMK) (APC)
MBS6167648-01 0.1 mL

LIMK1 (LIM Domain Kinase 1, LIMK) (APC)

Sign In for Pricing
View Details
LIMK1 (LIM Domain Kinase 1, LIMK) (APC)
MBS6167648-02 5x 0.1 mL

LIMK1 (LIM Domain Kinase 1, LIMK) (APC)

Sign In for Pricing
View Details
Rabbit Polyclonal SUCLG2 Antibody [Alexa Fluor 594]
NBP2-97953AF594 0.1 mL

Rabbit Polyclonal SUCLG2 Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details