Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Arg1 protein

This Mouse Arg1 protein spans the amino acid sequence from region 1-323aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Liver-type arginaseType I arginase

UniProt

Q61176

Expression Region

1-323aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics, Immunology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

50.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSSKPKSLEIIGAPFSKGQPRGGVEKGPAALRKAGLLEKLKETEYDVRDHGDLAFVDVPNDSSFQIVKNPRSVGKANEELAGVVAEVQKNGRVSVVLGGDHSLAVGSISGHARVHPDLCVIWVDAHTDINTPLTTSSGNLHGQPVSFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPAFTPATGTPVLGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTAEEVKSTVNTAVALTLACFGTQREGNHKPGTDYLKPPK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

6330403K07Rik (NM_134022) Mouse Recombinant Protein
TP500596 20 µg

6330403K07Rik (NM_134022) Mouse Recombinant Protein

Sign In for Pricing
View Details
Human Secretory Immunoglobulin A (sIgA) ELISA Kit
JL10115-01 48 Tests

Human Secretory Immunoglobulin A (sIgA) ELISA Kit

Sign In for Pricing
View Details
Human Secretory Immunoglobulin A (sIgA) ELISA Kit
JL10115-02 96 Tests

Human Secretory Immunoglobulin A (sIgA) ELISA Kit

Sign In for Pricing
View Details
Human IFNA2 protein
orb246107-01 20 µg

Human IFNA2 protein

Sign In for Pricing
View Details
Human IFNA2 protein
orb246107-02 100 µg

Human IFNA2 protein

Sign In for Pricing
View Details
Human IFNA2 protein
orb246107-03 1 mg

Human IFNA2 protein

Sign In for Pricing
View Details