Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IFNA2 protein

This Human IFNA2 protein spans the amino acid sequence from region 24-188aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IFNA2

UniProt

P01563

Expression Region

24-188aa

Tag

N-terminal 6xHis-tagged

Source

Yeast

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

H3FC (HIST1H3C) (NM_003531) Human Over-expression Lysate
LS008352 100 µg

H3FC (HIST1H3C) (NM_003531) Human Over-expression Lysate

Sign In for Pricing
View Details
Biphenyl-4-sulfonyl chloride
C11021-25mg 25 mg

Biphenyl-4-sulfonyl chloride

Sign In for Pricing
View Details
ZFYVE1 (NM_021260) Human Tagged ORF Clone
RG208288 10 µg

ZFYVE1 (NM_021260) Human Tagged ORF Clone

Sign In for Pricing
View Details
C2orf73 CRISPR Activation Plasmid (h)
sc-414356-ACT 20 µg

C2orf73 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Msx3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7021408 1.0 µg DNA

Msx3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Cytokeratin 18 Monoclonal Antibody
orb1821351 0.02 mg

Cytokeratin 18 Monoclonal Antibody

Sign In for Pricing
View Details