Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NRN1 protein

This Human NRN1 protein spans the amino acid sequence from region 28-116aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NRN1

UniProt

Q9NPD7

Expression Region

28-116aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

This is His-SUMO-tag protein

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AGKCDAVFKGFSDCLLKLGDSMANYPQGLDDKTNIKTVCTYWEDFHSCTVTALTDCQEGAKDMWDKLRKESKNLNIQGSLFELCGSGNG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GDNF Mouse
OM297612-01 10 µg

GDNF Mouse

Sign In for Pricing
View Details
GDNF Mouse
OM297612-02 2 µg

GDNF Mouse

Sign In for Pricing
View Details
GDNF Mouse
OM297612-03 1 mg

GDNF Mouse

Sign In for Pricing
View Details
Recombinant Human BAFF Protein
orb2994098-01 10 µg

Recombinant Human BAFF Protein

Sign In for Pricing
View Details
Recombinant Human BAFF Protein
orb2994098-02 50 µg

Recombinant Human BAFF Protein

Sign In for Pricing
View Details
Recombinant Human BAFF Protein
orb2994098-03 500 µg

Recombinant Human BAFF Protein

Sign In for Pricing
View Details