Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Fibroblast growth factor 23 protein (FGF23) (Active)

Product Specifications

Product Name Alternative

FGF-23, Tumor-derived hypophosphatemia-inducing factor

Abbreviation

Recombinant Human FGF23 protein (Active)

Gene Name

FGF23

UniProt

Q9GZV9

Expression Region

25-251aa

Organism

Homo sapiens (Human)

Target Sequence

YPNASPLLGSSWGGLIHLYTATARNSYHLQIHKNGHVDGAPHQTIYSALMIRSEDAGFVVITGVMSRRYLCMDFRGNIFGSHYFDPENCRFQHQTLENGYDVYHSPQYHFLVSLGRAKRAFLPGMNPPPYSQFLSRRNEIPLIHFNTPIPRRHTRSAEDDSERDPLNVLKPRARMTPAPASCSQELPSAEDNSPMASDPLGVVRGGRVNTHAGGTGPEGCRPFAKFI

Tag

Tag-Free

Type

Active Protein & In Stock Protein

Source

E.Coli

Field of Research

Cancer

Relevance

Regulator of phosphate homeostasis. Inhibits renal tubular phosphate transport by reducing SLC34A1 levels. Upregulates EGR1 expression in the presence of KL (By similarity) . Acts directly on the parathyroid to decrease PTH secretion (By similarity) . Regulator of vitamin-D metabolism. Negatively regulates osteoblast differentiation and matrix mineralization. {ECO:0000250, ECO:0000269|PubMed:11062477, ECO:0000269|PubMed:11409890, ECO:0000269|PubMed:15040831, ECO:0000269|PubMed:16597617, ECO:0000269|PubMed:18282132}.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

>95% as determined by SDS-PAGE.

Activity

Yes

Bioactivity

Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 0.5 μg/ml, corresponding to a specific activity of > 2.0 x 103 IU/mg in the presence of 0.3 µg/ml of rMuKlotho and 10 μg/ml of heparin.

Form

Lyophilized powder

Buffer

Lyophilized from a 0.2 µm filtered PBS, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Regulator of phosphate homeostasis. Inhibits renal tubular phosphate transport by reducing SLC34A1 levels. Upregulates EGR1 expression in the presence of KL (By similarity) . Acts directly on the parathyroid to decrease PTH secretion (By similarity) . Regulator of vitamin-D metabolism. Negatively regulates osteoblast differentiation and matrix mineralization.

Molecular Weight

25.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TrkA (NTRK1) Mouse Monoclonal Antibody [Clone ID: 6B2]
AM06329SU-N 100 µL

TrkA (NTRK1) Mouse Monoclonal Antibody [Clone ID: 6B2]

Sign In for Pricing
View Details
Human KRTAP22-2 activation kit by CRISPRa
GA119229 1 Kit

Human KRTAP22-2 activation kit by CRISPRa

Sign In for Pricing
View Details
GART Rabbit Polyclonal Antibody
TA368358 100 µL

GART Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PE/iFluor® 700 Anti-human CD15 Antibody *HI98*
101501X0-AAT 25 Tests

PE/iFluor® 700 Anti-human CD15 Antibody *HI98*

Sign In for Pricing
View Details
MTERFD1 Recombinant Mouse Monoclonal Antibody [A8-A10-R]
HA601237 100 µL

MTERFD1 Recombinant Mouse Monoclonal Antibody [A8-A10-R]

Sign In for Pricing
View Details
Recombinant Human PRDM2/RIZ1 Protein
PKSH031203 100 µg

Recombinant Human PRDM2/RIZ1 Protein

Sign In for Pricing
View Details