Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAP1LC3A, Human (His)

MAP1LC3A is a key ubiquitin-like modifier essential for autophagosome vacuole formation, ensuring cellular homeostasis. As part of the GABARAP/GATE-16 subfamily, it plays a crucial role in late autophagosome maturation. MAP1LC3A Protein, Human (His) is the recombinant human-derived MAP1LC3A protein, expressed by E. coli , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

MAP1LC3A Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/map1lc3a-protein-human-his.html

Smiles

MPSDRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF

Molecular Formula

84557 (Gene_ID) Q9H492-1 (M1-F121) (Accession)

Molecular Weight

Approximately 18 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Dry ice.

Scientific Category

Recombinant Proteins

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR110 (ADGRF1) (NM_153840) Human Tagged Lenti ORF Clone
RC222706L2 10 µg

GPR110 (ADGRF1) (NM_153840) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Signal Enhancer Hikari
B5357-250 250 mL

Signal Enhancer Hikari

Sign In for Pricing
View Details
LOXL2 Rabbit pAb (APR21194N)
APR21194N-01 50 µL

LOXL2 Rabbit pAb (APR21194N)

Sign In for Pricing
View Details
LOXL2 Rabbit pAb (APR21194N)
APR21194N-02 100 µL

LOXL2 Rabbit pAb (APR21194N)

Sign In for Pricing
View Details
LOXL2 Rabbit pAb (APR21194N)
APR21194N-03 200 µL

LOXL2 Rabbit pAb (APR21194N)

Sign In for Pricing
View Details
Lentiviral mouse Zfc3h1 shRNA (UAS) - Lentiviral mouse Zfc3h1 shRNA (UAS, GFP) (100)
GTR15171705 1 Vial

Lentiviral mouse Zfc3h1 shRNA (UAS) - Lentiviral mouse Zfc3h1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details