Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LOXL2 Rabbit pAb (APR21194N)

Product Specifications

Background

This gene encodes a member of the lysyl oxidase gene family. The prototypic member of the family is essential to the biogenesis of connective tissue, encoding an extracellular copper-dependent amine oxidase that catalyses the first step in the formation of crosslinks in collagens and elastin. A highly conserved amino acid sequence at the C-terminus end appears to be sufficient for amine oxidase activity, suggesting that each family member may retain this function. The N-terminus is poorly conserved and may impart additional roles in developmental regulation, senescence, tumor suppression, cell growth control, and chemotaxis to each member of the family.

Overview

We constantly strive to ensure we provide our customers with the best antibodies. As a result of this work we offer this antibody in purified format. We are in the process of updating our datasheets. If you have any questions regarding this update, please feel free to contact our technical support team. This product is a high quality LOXL2 Rabbit pAb (APR21194N) .

Synonyms

LOXL2; LOR; LOR2; WS9-14

Gene ID

4017

UniProt

Q9Y4K0

Cellular Locus

Chromosome, Nucleus, Secreted, basement membrane, extracellular matrix, extracellular space

Applications

WB (Homo sapiens)

Dilution

WB 1:500 - 1:2000

Form

Liquid

Buffer

Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.

Molecular Weight

Calculated MW: 86kDa Observed MW: 100KDa

Storage Conditions

Store at 4°C short term. For long-term storage, aliquot and store at -20°C or below. Stable for 12 months at -20°C. Avoid repeated freeze-thaw cycles.

Gene ID URL

https://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=gene&cmd=Retrieve&dopt=Graphics&list_uids=4017

Uniprot URL

https://www.uniprot.org/uniprot/Q9Y4K0

AA Sequence

VMSGVKCSGTELSLAHCRHDGEDVACPQGGVQYGAGVACSETAPDLVLNAEMVQQTTYLEDRPMFMLQCAMEENCLSASAAQTDPTTGYRRLLRFSSQIHNNGQSDFRPKNGRHAWIWHDCHRHYHSMEVFTHYDLLNLNGTKVAEGHKASFCLEDTECEGDIQKNYECANFGDQGITMGCWDMYRHDIDCQWVDITDVPPGDYLFQVVINPNFEVAESDYSNNIMKCRSRYDGHRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQLSPQ

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

UPF3A (Up-frameshift Suppressor 3 Homolog A, hUpf3, UPF3, Nonsense mRNA Reducing Factor 3A, Regulator of Nonsense Transcripts 3A, RENT3A) (Biotin)
135118-Biotin 100 µL

UPF3A (Up-frameshift Suppressor 3 Homolog A, hUpf3, UPF3, Nonsense mRNA Reducing Factor 3A, Regulator of Nonsense Transcripts 3A, RENT3A) (Biotin)

Ask
View Details
HHV-8/LNA-1 (Kaposi's Sarcoma-associated Herpesvirus, Human Herpesvirus-8, HHV-8/KSHV Orf73 LANA, HHV-8/KSHV Orf73 LNA, HHV-8/KSHV Orf73 LNA-1, HHV-8/KSHV Orf73 Latency-associated Nuclear Antigen, HHV-8/KSHV Orf73 Latent Nuclear Antigen, HHV-8/KSHV Orf73 Latent Nuclear Antigen-1) (FITC)
366954-FITC 100 µL

HHV-8/LNA-1 (Kaposi's Sarcoma-associated Herpesvirus, Human Herpesvirus-8, HHV-8/KSHV Orf73 LANA, HHV-8/KSHV Orf73 LNA, HHV-8/KSHV Orf73 LNA-1, HHV-8/KSHV Orf73 Latency-associated Nuclear Antigen, HHV-8/KSHV Orf73 Latent Nuclear Antigen, HHV-8/KSHV Orf73 Latent Nuclear Antigen-1) (FITC)

Ask
View Details
Recombinant Canine Leptin Protein, Untagged, E.coli-100ug
QP10754-100ug 100ug

Recombinant Canine Leptin Protein, Untagged, E.coli-100ug

Ask
View Details
Rabbit Polyclonal HSP60 Antibody [mFluor Violet 610 SE]
NBP1-77397MFV610 0.1 mL

Rabbit Polyclonal HSP60 Antibody [mFluor Violet 610 SE]

Ask
View Details
EFHC1 (NM_018100) Human Tagged ORF Clone Lentiviral Particle
RC205830L4V 200 µL

EFHC1 (NM_018100) Human Tagged ORF Clone Lentiviral Particle

Ask
View Details
NDST4 (NM_022569) Human Over-expression Lysate
LC411635 20 µg

NDST4 (NM_022569) Human Over-expression Lysate

Ask
View Details