Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD164, Rat (HEK293, Fc)

CD164 Protein, a sialomucin, crucially influences hematopoiesis and cell adhesion. It enhances myogenesis by positively regulating myoblast migration and promoting the fusion of myoblasts into myotubes through interactions with CXCR4. This highlights CD164's significant role in various cellular activities related to muscle development and function. CD164 Protein, Rat (HEK293, Fc) is the recombinant rat-derived CD164 protein, expressed by HEK293 , with C-hFc labeled tag.

Product Specifications

Product Name Alternative

CD164 Protein, Rat (HEK293, Fc), Rat, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/cd164-protein-rat-hek293-fc.html

Purity

98.0

Smiles

QSNSSASPNVTDPPTTTSKVVPTTLTTTKPPETCESFNSCVSCVNATLTNNITCVWLDCHEANKTYCSSELVSNCTQKTSTDSCSVIPTTPVPTNSTAKPTTRPSSPTPTPSVVTSAGATNTTVTPTSQPERKSTFD

Molecular Formula

83689 (Gene_ID) Q9QX82 (Q24-D160) (Accession)

Molecular Weight

Approximately 90-120 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Histidase (HAL) (NM_002108) Human Tagged Lenti ORF Clone
RC211651L2 10 µg

Histidase (HAL) (NM_002108) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Pipette Filter tips, 0.1-10 uL, Natural, Bulk, DNase/RNase free - 1000 un. - ABDOS
P11001 1000 Units/Pack

Pipette Filter tips, 0.1-10 uL, Natural, Bulk, DNase/RNase free - 1000 un. - ABDOS

Sign In for Pricing
View Details
Anti-EDA2R Polyclonal Antibody
TMAB-05434-01 50 μL

Anti-EDA2R Polyclonal Antibody

Sign In for Pricing
View Details
Anti-EDA2R Polyclonal Antibody
TMAB-05434-02 100 µL

Anti-EDA2R Polyclonal Antibody

Sign In for Pricing
View Details
Anti-EDA2R Polyclonal Antibody
TMAB-05434-03 200 µL

Anti-EDA2R Polyclonal Antibody

Sign In for Pricing
View Details
TMEM143 siRNA (Mouse)
CRM8173-01 15 nmol

TMEM143 siRNA (Mouse)

Sign In for Pricing
View Details