Collagen Alpha-1 (XVIII) Chain/Endostatin, Human (P.pastoris)
Endostatin Protein, Human (P.pastoris) is an endogenous antiangiogenic peptide with multiple antitumor roles through modulation of various receptors in the plasma membrane, such as suppression of angiogenesis and inhibition of tumor-cell migration and invasion.
Product Specifications
Product Name Alternative
Collagen Alpha-1 (XVIII) Chain/Endostatin Protein, Human (P.pastoris), Human, P. pastoris
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/endostatin-protein-human-p-pastoris.html
Purity
97.00
Smiles
AHSHRDFQPVLHLVALNSPLSGGMRGIRGADFQCFQQARAVGLAGTFRAFLSSRLQDLYSIVRRADRAAVPIVNLKDELLFPSWEALFSGSEGPLKPGARIFSFDGKDVLRHPTWPQKSVWHGSDPNGRRLTESYCETWRTEAPSATGQASSLLGGRLLGQSAASCHHAYIVLCIENSFMTASK
Molecular Formula
80781 (Gene_ID) P39060-3 (A1571-K1754) (Accession)
Molecular Weight
Approximately 16 kDa
References & Citations
[1]Guo ZY, et al. Effect of recombinant human endostatin on the expression of c-Myc and bFGF in mouse gastric cancer cells. Genet Mol Res. 2015 May 18;14 (2) :5258-65.|[2]Ren Z, et al. Anti-tumor effect of a novel soluble recombinant human endostatin: administered as a single agent or in combination with chemotherapy agents in mouse tumor models. PLoS One. 2014 Sep 17;9 (9) :e107823.
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC880460-500 1x 500 µL
CD44 Standard (156-3C11), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470030-500 1x 500 µL
Insulin (2D11-H5), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940012-500 1x 500 µL
Tyrosinase (T311), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680181-100 1x 100 µL
CD59 (heavy chain of Protectin) (BRA-10G), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041203-100 1x 100 µL
Smooth Muscle Actin (ACTA2/791 +1A4), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details