Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PDGF-BB, Rat

PDGF-BB Protein, Rat is a member of PDGF family, which promotes cell proliferation, survival and migration, through binding to the tyrosine kinase PDGF receptor.

Product Specifications

Product Name Alternative

PDGF-BB Protein, Rat, Rat, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pdgf-bb-protein-rat.html

Purity

97.00

Smiles

SLGSLAAAEPAVIAECKTRTEVFQISRNLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRASQVQMRPVQVRKIEIVRKKPVFKKATVTLEDHLACKCETVVTPRPVT

Molecular Formula

24628 (Gene_ID) Q05028 (S74-T182) (Accession)

Molecular Weight

Approximately 15-16 kDa, based on SDS-PAGE under reducing conditions, due to the glycosylation.

References & Citations

[1]Badwelan M, et al. The Efficacy of Recombinant Platelet-Derived Growth Factor on Beta-Tricalcium Phosphate to Regenerate Femoral Critical Sized Segmental Defects: Longitudinal In Vivo Micro-CT Study in a Rat Model. J Invest Surg. 2018 Nov 15:1-13.|[2]Zhao F, et al. Effect of platelet-derived growth factor-BB on gap junction and connexin43 in rat penile corpus cavernosum smooth muscle cells. Andrologia. 2018 Nov 23:e13200.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aldh3b2 Mouse Gene Knockout Kit (CRISPR)
KN501122 1 Kit

Aldh3b2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
VU0467154
SIH-184-10MG 10 mg

VU0467154

Sign In for Pricing
View Details
4H-Thieno[3,2-c]chromene-2-carboxylic acid
TRC-H956113-25MG 25 mg

4H-Thieno[3,2-c]chromene-2-carboxylic acid

Sign In for Pricing
View Details
TXNDC12 Polyclonal Antibody
E-AB-19142-01 20 µL

TXNDC12 Polyclonal Antibody

Sign In for Pricing
View Details
TXNDC12 Polyclonal Antibody
E-AB-19142-02 60 µL

TXNDC12 Polyclonal Antibody

Sign In for Pricing
View Details
TXNDC12 Polyclonal Antibody
E-AB-19142-03 120 µL

TXNDC12 Polyclonal Antibody

Sign In for Pricing
View Details