Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A3, Mouse (His)

S100A3 Protein, acting as a homodimer with disulfide linkages, exhibits strong binding affinity for beta-galactoside and lactose.Notably, it potently induces T-cell apoptosis, as demonstrated in various studies, and displays hemagglutinating activity towards chicken erythrocytes.These properties underscore S100A3's multifaceted roles in cellular interactions and immune modulation.S100A3 Protein, Mouse (His) is the recombinant mouse-derived S100A3 protein, expressed by E.coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

S100A3 Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/s100a3-protein-mouse-his.html

Purity

96.00

Smiles

MTRPLEQAVAAIVCTFQEYAGRCGDKYKICQSELKELLQKELPTWTPSEFRECDYNKFMSVLDTNKDCEVDFGEYVRSLASLCLYCHEYFKECPPEPPCPQ

Molecular Formula

20197 (Gene_ID) P62818 (M1-Q101) (Accession)

Molecular Weight

Approximately 12 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CNTN1, ID (CNTN1, Contactin-1, Glycoprotein gp135, Neural cell surface protein F3) (FITC)
MBS6287364-01 0.2 mL

CNTN1, ID (CNTN1, Contactin-1, Glycoprotein gp135, Neural cell surface protein F3) (FITC)

Sign In for Pricing
View Details
CNTN1, ID (CNTN1, Contactin-1, Glycoprotein gp135, Neural cell surface protein F3) (FITC)
MBS6287364-02 5x 0.2 mL

CNTN1, ID (CNTN1, Contactin-1, Glycoprotein gp135, Neural cell surface protein F3) (FITC)

Sign In for Pricing
View Details
Slc15a3 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3437104 1.0 µg DNA

Slc15a3 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
STAT6 Recombinant Antibody, PE-Cy7 Conjugated
bsm-52239R-PE-Cy7-TR 20 µL

STAT6 Recombinant Antibody, PE-Cy7 Conjugated

Sign In for Pricing
View Details
ADC-VI
HY-176927 1 Each

ADC-VI

Sign In for Pricing
View Details
Ribosomal Protein L36 Polyclonal Antibody
orb1412276 100 µL

Ribosomal Protein L36 Polyclonal Antibody

Sign In for Pricing
View Details