Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BCMA/TNFRSF17, Human

B Cell Maturation Antigen (BCMA) also referred to as TNFRSF17 or CD269, is a transmembrane glycoprotein member of the tumor necrosis factor receptor (TNFR) superfamily. BCMA is used as a biomarker for Multiple myeloma (MM) . BCMA mainly plays an important role in B cells for their proliferation, survival and also differentiates them into plasma cells[1]. BCMA/TNFRSF17 Protein, Human is a recombinant protein consisting of 50 amino acids (A5-A54) and is produced in E. coli cells.

Product Specifications

Product Name Alternative

BCMA/TNFRSF17 Protein, Human, Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Applications

Neuroscience-Neuromodulation

Assay Protocol

https://www.medchemexpress.com/cytokines/bcma-tnfrsf17-protein-human.html

Purity

95.0

Smiles

AGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA

Molecular Formula

608 (Gene_ID) Q02223 (A5-A54) (Accession)

Molecular Weight

Approximately 5.4 kDa

References & Citations

[1]Hatzoglou A, et al. TNF receptor family member BCMA (B cell maturation) associates with TNF receptor-associated factor (TRAF) 1, TRAF2, and TRAF3 and activates NF-kappa B, elk-1, c-Jun N-terminal kinase, and p38 mitogen-activated protein kinase. J Immunol. 2000 Aug 1;165 (3) :1322-30.|[2]Tai YT, et al. APRIL and BCMA promote human multiple myeloma growth and immunosuppression in the bone marrow microenvironment. Blood. 2016 Jun 23;127 (25) :3225-36.|[3]Nobari ST, et al. B-cell maturation antigen targeting strategies in multiple myeloma treatment, advantages and disadvantages. J Transl Med. 2022 Feb 10;20 (1) :82.|[4]Yu B, et al. BCMA-targeted immunotherapy for multiple myeloma. J Hematol Oncol. 2020 Sep 17;13 (1) :125.|[5]Perez-Amill L, et al. Preclinical development of a humanized chimeric antigen receptor against B cell maturation antigen for multiple myeloma. Haematologica. 2021 Jan 1;106 (1) :173-184.|[6]Sanchez E, et al. Soluble B-Cell Maturation Antigen Mediates Tumor-Induced Immune Deficiency in Multiple Myeloma. Clin Cancer Res. 2016 Jul 1;22 (13) :3383-97.|[7]O'Connor BP, et al. BCMA is essential for the survival of long-lived bone marrow plasma cells. J Exp Med. 2004 Jan 5;199 (1) :91-8.|[8]Tai YT, et al. APRIL and BCMA promote human multiple myeloma growth and immunosuppression in the bone marrow microenvironment. Blood. 2016 Jun 23;127 (25) :3225-36.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DCTD Human Gene Knockout Kit (CRISPR)
KN417231 1 Kit

DCTD Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FITC Conjugated Phaseolus lunatus Lectin (Lima Bean) -LBA-
F-1701-1 1 mg

FITC Conjugated Phaseolus lunatus Lectin (Lima Bean) -LBA-

Sign In for Pricing
View Details
TFE3 Recombinant Rabbit Monoclonal Antibody [JE60-60]
HA721896 100 µL

TFE3 Recombinant Rabbit Monoclonal Antibody [JE60-60]

Sign In for Pricing
View Details
Recombinant Human PCNA protein (His tag)
PDEH100932-01 20 µg

Recombinant Human PCNA protein (His tag)

Sign In for Pricing
View Details
Recombinant Human PCNA protein (His tag)
PDEH100932-02 100 µg

Recombinant Human PCNA protein (His tag)

Sign In for Pricing
View Details
Recombinant Human PCNA protein (His tag)
PDEH100932-03 500 µg

Recombinant Human PCNA protein (His tag)

Sign In for Pricing
View Details