Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Transforming growth factor beta-2 proprotein (TGFB2), partial

Product Specifications

Product Name Alternative

(Milk growth factor) (MGF)

Abbreviation

Recombinant Bovine TGFB2 protein, partial

Gene Name

TGFB2

UniProt

P21214

Expression Region

303-414aa

Organism

Bos taurus (Bovine)

Target Sequence

ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMIVKSCKCS

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Signal Transduction

Relevance

[Transforming growth factor beta-2 proprotein]: Precursor of the Latency-associated peptide (LAP) and Transforming growth factor beta-2 (TGF-beta-2) chains, which constitute the regulatory and active subunit of TGF-beta-2, respectively.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

20.2 kDa

References & Citations

"The genome sequence of taurine cattle: a window to ruminant biology and evolution." The bovine genome sequencing and analysis consortium Science 324:522-528 (2009) .

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

VENTX (NM_014468) Human Recombinant Protein
TP311761M 100 µg

VENTX (NM_014468) Human Recombinant Protein

Sign In for Pricing
View Details
SRP1/KPNA1 Rabbit Polyclonal Antibody (Biotin)
orb2604509 100 µg

SRP1/KPNA1 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
MRPL13 Protein Vector (Human) (pPM-C-HA)
PV026507 500 ng

MRPL13 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
CSNK1G3 (NM_004384) Human Tagged ORF Clone Lentiviral Particle
RC222490L4V 200 µL

CSNK1G3 (NM_004384) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Medetomidine-13C, d3 (hydrochloride)
HY-17034BS1 1 mg

Medetomidine-13C, d3 (hydrochloride)

Sign In for Pricing
View Details
KLF3 Antibody - N-terminal region : FITC (ARP72744_P050-FITC)
ARP72744_P050-FITC 100 µL

KLF3 Antibody - N-terminal region : FITC (ARP72744_P050-FITC)

Sign In for Pricing
View Details