KGF-2/FGF-10, Mouse
KGF-2/FGF-10 Protein, Mouse is a paracrine signaling molecule and is involved in the branching of morphogenesis in multiple organs such as the lungs, skin, ear and salivary glands.
Product Specifications
Product Name Alternative
KGF-2/FGF-10 Protein, Mouse, Mouse, E. coli
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/kgf-2-fgf-10-protein-mouse.html
Purity
95.00
Smiles
SSAGRHVRSYNHLQGDVRWRRLFSFTKYFLTIEKNGKVSGTKNEDCPYSVLEITSVEIGVVAVKAINSNYYLAMNKKGKLYGSKEFNNDCKLKERIEENGYNTYASFNWQHNGRQMYVALNGKGAPRRGQKTRRKNTSAHFLPMTIQT
Molecular Formula
14165 (Gene_ID) O35565 (S62-T209) (Accession)
Molecular Weight
Approximately 17 kDa, based on SDS-PAGE under reducing conditions.
References & Citations
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
Available Sizes
Explore Other Products
Discover premium biology products from our extensive collection of 20M+ items
SCARB1, NT (SCARB1, CD36L1, CLA1, Scavenger receptor class B member 1, CD36 and LIMPII analogous 1, CD36 antigen-like 1, Collagen type I receptor, thrombospondin receptor-like 1, SR-BI, CD36) (Azide free) (HRP)
SCARB1, NT (SCARB1, CD36L1, CLA1, Scavenger receptor class B member 1, CD36 and LIMPII analogous 1, CD36 antigen-like 1, Collagen type I receptor, thrombospondin receptor-like 1, SR-BI, CD36) (Azide free) (HRP)
