Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DiagNano™ Streptavidin conjugated Gold Nanoparticles, 30 nm

Product Specifications

No additional specifications available.

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig cecropin ELISA Kit
EIA05461Gu 1 Kit

Guinea pig cecropin ELISA Kit

Sign In for Pricing
View Details
STIEEQAKTFLDKFNHEAEDLFYQSSLASWN
MBS5818107 Inquire

STIEEQAKTFLDKFNHEAEDLFYQSSLASWN

Sign In for Pricing
View Details
pCMV-SPORT6-Sox18 Plasmid
PVT55670 2 µg

pCMV-SPORT6-Sox18 Plasmid

Sign In for Pricing
View Details
Recombinant Human CATSPERZ Protein
E30P6668 20 µg

Recombinant Human CATSPERZ Protein

Sign In for Pricing
View Details
TPM2 Adenovirus (Rat)
47367056 1.0 mL

TPM2 Adenovirus (Rat)

Sign In for Pricing
View Details
Anti-Mouse COMP Antibody (15A11)
MBS1568982-01 0.1 mg

Anti-Mouse COMP Antibody (15A11)

Sign In for Pricing
View Details