Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DLK-1/Pref-1, soluble

Delta-like 1 (DLK1), also known as Pref-1 and FA1, is a transmembrane protein pertaining to the epidermal growth factor superfamily. DLK1 affects several differentiation processes, including adipogenesis, muscular and neuronal differentiation, bone differentiation, and haematopoiesis. Several reports support that DLK1 may operate as a non-canonical ligand of the NOTCH pathway. Since the NOTCH signaling pathway is essential for vascular development and physiology by controlling angiogenesis in pre- and post-natal life, it was reasoned that DLK1 could contribute to regulate this process in adult endothelial cells through the interaction with NOTCH receptors. It was found that overexpression of DLK1 inhibits migration and angiotube formation in mammalian vascular endothelial cells and disrupts normal embryonic vascularization in zebrafish. Genetic ablation of DLK1 in mice is associated with increased angiogenesis in vitro and with focal areas of retinal hyper-vascularization. Specific knockdown of the orthologous Dlk1 of zebrafish results in ectopic angiogenesis. Moreover, in a tumor angiogenesis model in zebrafish, suppression of Dlk1 promotes vessel migration towards the tumor cell mass. It was also found that the NOTCH signaling pathway is targeted by DLK1 in the context of angiogenesis and that DLK1 antagonizes NOTCH-dependent signaling in endothelial cells, while, in contrast, this signaling is enhanced in Dlk1-null mice. Collectively, these results revealed a previously unknown role for DLK1 in the vasculature as a regulator of NOTCH-mediated angiogenesis.

Product Specifications

Synonyms

Protein delta homolog 1, pG2, Fetal antigen 1, FA1, ZOG

NCBI Gene ID

8788

UniProt

P80370

Accession Number

NP_003827.3

Accession Number mRNA

NM_003836.5

Reactivity

Human

Cross Reactivity

Human

Label

His-Tag

Sequence

AECFPACNPQNGFCEDDNVCRCQPGWQGPLCDQCVTSPGCLHGLCGEPGQCICTDGWDGELCDRDVRACSSAPCANNGTCVSLDDGLYECSCAPGYSGKDCQKKDGPCVINGSPCQHGGTCVDDEGRASHASCLCPPGFSGNFCEIVANSCTPNPCENDGVCTDIGGDFRCRCPAGFIDKTCSRPVTNCASSPCQNGGTCLQHTQVSYECLCKPEFTGLTCVKKRALSPQQVTRLPSGYGLAYRLTPGVHELPVQQPEHRILKVSMKELNKKTPLEHHHHHH

Assay Protocol

Centrifuge vial prior to opening. Human sDLK1/Pref1 should be reconstituted in water to a concentration of 0.1 mg/ml. This solution can be diluted in water or other buffer solutions or stored at -20°C.

Purity

> 98% by SDS-PAGE

Length

282

Form

Lyophilized

Buffer

PBS

Reconstitution

Water

Molecular Weight

32.2 kDa

Storage Conditions

The lyophilized human sDLK1/Pref1, though stable at room temperature, is best stored desiccated below 0°C. Reconstituted human sDLK1/Pref1 should be stored in working aliquots at -20°C.

Host or Source

E. coli

N Terminal Sequence

AECFP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C1QTNF6 Protein Lysate (Mouse) with C-HA Tag
14254035 100 µg

C1QTNF6 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
PYCR2 Rabbit Polyclonal Antibody (HRP)
orb2105831 100 µL

PYCR2 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Goat Cell cycle checkpoint control protein RAD9B (RAD9B) ELISA Kit
MBS7228173-01 48 Well

Goat Cell cycle checkpoint control protein RAD9B (RAD9B) ELISA Kit

Sign In for Pricing
View Details
Goat Cell cycle checkpoint control protein RAD9B (RAD9B) ELISA Kit
MBS7228173-02 96 Well

Goat Cell cycle checkpoint control protein RAD9B (RAD9B) ELISA Kit

Sign In for Pricing
View Details
Goat Cell cycle checkpoint control protein RAD9B (RAD9B) ELISA Kit
MBS7228173-03 5x 96 Well

Goat Cell cycle checkpoint control protein RAD9B (RAD9B) ELISA Kit

Sign In for Pricing
View Details
Goat Cell cycle checkpoint control protein RAD9B (RAD9B) ELISA Kit
MBS7228173-04 10x 96 Well

Goat Cell cycle checkpoint control protein RAD9B (RAD9B) ELISA Kit

Sign In for Pricing
View Details