Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PYCR2 Rabbit Polyclonal Antibody (HRP)

PYCR2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HLD10, P5CR2

UniProt

Q96C36

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PYCR2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LINAVEASCIRTRELQSMADQEKISPAALKKTLLDRVKLESPTVSTLTPS

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_037460

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Vibrio Cholerae alr2 Protein (aa 1-392)
VAng-Cr3183-500gEcoli 500 µg (E. coli)

Recombinant Vibrio Cholerae alr2 Protein (aa 1-392)

Sign In for Pricing
View Details
Human Pepsin (PP) ELISA Kit
QY-E01049 96 Tests

Human Pepsin (PP) ELISA Kit

Sign In for Pricing
View Details
CBR1 Rabbit Polyclonal Antibody (FITC)
orb2117601 100 µL

CBR1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
Rabbit Polyclonal ZFYVE21 Antibody [FITC]
NBP2-82050F 0.1 mL

Rabbit Polyclonal ZFYVE21 Antibody [FITC]

Sign In for Pricing
View Details
Human Uncharacterized protein C1orf182, C1orf182 ELISA KIT
ELI-10855h 96 Tests

Human Uncharacterized protein C1orf182, C1orf182 ELISA KIT

Sign In for Pricing
View Details
ACVRL1 Rabbit Monoclonal Antibody
E56G2321 100 µL

ACVRL1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details