Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PD-L1, Human (HEK293)

The PD-L1 protein critically regulates immune tolerance by acting as a ligand for PDCD1/PD-1, regulating T cell activation threshold, and limiting effector responses. It may act as a costimulatory molecule for IL10-producing T cell subsets. PD-L1 Protein, Human (HEK293) is the recombinant human-derived PD-L1 protein, expressed by HEK293 , with tag free.

Product Specifications

Product Name Alternative

PD-L1 Protein, Human (HEK293), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/pd-l1-protein-human-hek293.html

Purity

98.0

Smiles

FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER

Molecular Formula

29126 (Gene_ID) Q9NZQ7-1/NP_054862.1 (F19-R238) (Accession)

Molecular Weight

Approximately 31-40 kDa due to the glycosylation.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TASOR2 (NM_017782) Human Untagged Clone
SC318726 10 µg

TASOR2 (NM_017782) Human Untagged Clone

Sign In for Pricing
View Details
Recombinant human NDUFAF1 protein
ATGP1775-500 500 µg

Recombinant human NDUFAF1 protein

Sign In for Pricing
View Details
Goat Beta Synuclein ELISA Kit
MBS073084 Inquire

Goat Beta Synuclein ELISA Kit

Sign In for Pricing
View Details
IFNGR1 Protein (C-10xHis tag, )
P511546 100 µg

IFNGR1 Protein (C-10xHis tag, )

Sign In for Pricing
View Details
Phospho-mTOR (Ser 2448) Rabbit mAb
C06292-20uL 20 µL

Phospho-mTOR (Ser 2448) Rabbit mAb

Sign In for Pricing
View Details
Rnaset2a (NM_001083938) Mouse Tagged ORF Clone Lentiviral Particle
MR219272L4V 200 µL

Rnaset2a (NM_001083938) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details