Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MAPK1/ERK2, Human (sf9, His)

ERK2 Protein, a key component of the MAPK/ERK cascade, regulates diverse cellular processes such as transcription, translation, mitosis, apoptosis, endosomal dynamics, and Golgi apparatus fragmentation. Through phosphorylation, it modulates substrates including transcription factors, cytoskeletal elements, apoptosis regulators, translation regulators, protein kinases, and phosphatases. MAPK1/ERK2 Protein, Human (sf9, His) is the recombinant human-derived ERK2 protein, expressed by Sf9 insect cells , with C-His labeled tag.

Product Specifications

Product Name Alternative

MAPK1/ERK2 Protein, Human (sf9, His), Human, Sf9 insect cells

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/erk2-protein-human-sf9-gst.html

Purity

95.00

Smiles

MAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDLYKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDKMLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRS

Molecular Formula

5594 (Gene_ID) P28482-1 (M1-S360) (Accession)

Molecular Weight

Approximately 42 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDC42 binding protein kinase alpha (CDC42BPA) Mouse Monoclonal Antibody [Clone ID: OTI12C12]
CF808221 100 µg

CDC42 binding protein kinase alpha (CDC42BPA) Mouse Monoclonal Antibody [Clone ID: OTI12C12]

Sign In for Pricing
View Details
Tissue FFPE Sections, Kidney
CS703181 5x 5 µm

Tissue FFPE Sections, Kidney

Sign In for Pricing
View Details
STAT2 (STAT2/2650), CF568 conjugate, 0.1mg/mL
BNC682650-500 1x 500 µL

STAT2 (STAT2/2650), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant Phospho-Tau (Thr217) Monoclonal Antibody
AN300377L-01 20 µL

Recombinant Phospho-Tau (Thr217) Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Phospho-Tau (Thr217) Monoclonal Antibody
AN300377L-02 100 µL

Recombinant Phospho-Tau (Thr217) Monoclonal Antibody

Sign In for Pricing
View Details
C6ORF182 (CEP57L1) (NM_001083535) Human Over-expression Lysate
LC421215 20 µg

C6ORF182 (CEP57L1) (NM_001083535) Human Over-expression Lysate

Sign In for Pricing
View Details