Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-17A, Rabbit

IL-17A is a homodimeric cytokine and plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides, cytokines, chemokines, and matrix metalloproteinases[1][2]. IL-17A Protein, Rabbit is a recombinant rabbit IL-17A protein and is expressed in E. coli. It consists of 130 amino acids (G24-A153) .

Product Specifications

Product Name Alternative

IL-17A Protein, Rabbit, Rabbit, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-17a-protein-rabbit-tag-free.html

Purity

96.00

Smiles

GIAMPRNPGCPNAEDKNFPQNVKVSLNILNKSVNSRRPSDYYNRSTSPWTLHRNEDRERYPSVIWEAKCRHLGCVNAEGNEDHHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIIHHMA

Molecular Formula

100339322 (Gene_ID) G1SLF2 (G24-A153) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rab22a (NM_001108966) Rat Tagged ORF Clone
RR208833 10 µg

Rab22a (NM_001108966) Rat Tagged ORF Clone

Sign In for Pricing
View Details
WDR67 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2634505 3x 1.0 µg

WDR67 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Recombinant human CARD17 protein
ATGP2311-100 100 µg

Recombinant human CARD17 protein

Sign In for Pricing
View Details
5-[ (3-Chlorophenyl) methyl]-1,3,4-thiadiazol-2-amine
PBA18149-01 50 mg

5-[ (3-Chlorophenyl) methyl]-1,3,4-thiadiazol-2-amine

Sign In for Pricing
View Details
5-[ (3-Chlorophenyl) methyl]-1,3,4-thiadiazol-2-amine
PBA18149-02 0.5 g

5-[ (3-Chlorophenyl) methyl]-1,3,4-thiadiazol-2-amine

Sign In for Pricing
View Details
Anti-LXN/TCI Rabbit pAb
GB113785-50 50 μL

Anti-LXN/TCI Rabbit pAb

Sign In for Pricing
View Details