Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL-17A, Rabbit

IL-17A is a homodimeric cytokine and plays a critical role in host defense mechanisms against many bacterial and fungal pathogens as well as allergic and autoimmune responses. IL-17A induces the production of antimicrobial peptides, cytokines, chemokines, and matrix metalloproteinases[1][2]. IL-17A Protein, Rabbit is a recombinant rabbit IL-17A protein and is expressed in E. coli. It consists of 130 amino acids (G24-A153) .

Product Specifications

Product Name Alternative

IL-17A Protein, Rabbit, Rabbit, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/il-17a-protein-rabbit-tag-free.html

Purity

96.00

Smiles

GIAMPRNPGCPNAEDKNFPQNVKVSLNILNKSVNSRRPSDYYNRSTSPWTLHRNEDRERYPSVIWEAKCRHLGCVNAEGNEDHHMNSVPIQQEILVLRRESQHCPHSFRLEKMLVAVGCTCVTPIIHHMA

Molecular Formula

100339322 (Gene_ID) G1SLF2 (G24-A153) (Accession)

Molecular Weight

Approximately 16 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Atp6ap2 (NM_027439) Mouse Tagged ORF Clone
MR226121 10 µg

Atp6ap2 (NM_027439) Mouse Tagged ORF Clone

Ask
View Details
Goat anti Human Lambda Chain
40C-CB9128 1 mg

Goat anti Human Lambda Chain

Ask
View Details
Human INPP4A (Inositol Polyphosphate-4-Phosphatase Type I 107kDa) ELISA Kit
MBS8805085-01 48 Well

Human INPP4A (Inositol Polyphosphate-4-Phosphatase Type I 107kDa) ELISA Kit

Ask
View Details
Human INPP4A (Inositol Polyphosphate-4-Phosphatase Type I 107kDa) ELISA Kit
MBS8805085-02 96 Well

Human INPP4A (Inositol Polyphosphate-4-Phosphatase Type I 107kDa) ELISA Kit

Ask
View Details
Human INPP4A (Inositol Polyphosphate-4-Phosphatase Type I 107kDa) ELISA Kit
MBS8805085-03 5x 96 Well

Human INPP4A (Inositol Polyphosphate-4-Phosphatase Type I 107kDa) ELISA Kit

Ask
View Details
Human INPP4A (Inositol Polyphosphate-4-Phosphatase Type I 107kDa) ELISA Kit
MBS8805085-04 10x 96 Well

Human INPP4A (Inositol Polyphosphate-4-Phosphatase Type I 107kDa) ELISA Kit

Ask
View Details