Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Caspase-1 (CASP1), partial

Product Specifications

Product Name Alternative

Interleukin-1 beta convertase ; IL-1BCInterleukin-1 beta-converting enzyme ; ICE ; IL-1 beta-converting enzymep45

Abbreviation

Recombinant Human CASP1 protein, partial

Gene Name

CASP1

UniProt

P29466

Expression Region

120-269aa

Organism

Homo sapiens (Human)

Target Sequence

NPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIREGICGKKHSEQVPDILQLNAIFNMLNTKN

Tag

N-terminal GST-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Apoptosis

Relevance

Thiol protease that cleaves IL-1 beta between an Asp and an Ala, releasing the mature cytokine which is involved in a variety of inflammatory processes. Important for defense against pathogens. Cleaves and activates sterol regulatory elent binding proteins (SREBPs) . Can also promote apoptosis.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Function

Thiol protease that cleaves IL-1 beta between an Asp and an Ala, releasing the mature cytokine which is involved in a variety of inflammatory processes. Important for defense against pathogens. Cleaves and activates sterol regulatory element binding proteins (SREBPs) . Can also promote apoptosis. Upon inflammasome activation, during DNA virus infection but not RNA virus challenge, controls antiviral immunity through the cleavage of CGAS, rendering it inactive

Molecular Weight

43.8 kDa

References & Citations

A novel heterodimeric cysteine protease is required for interleukin-1 beta processing in monocytes.Thornberry N.A., Bull H.G., Calaycay J.R., Chapman K.T., Howard A.D., Kostura M.J., Miller D.K., Molineaux S.M., Weidner J.R., Aunins J., Elliston K.O., Ayala J.M., Casano F.J., Chin J., Ding G.J.-F., Egger L.A., Gaffney E.P., Limjuco G. , Palyha O.C., Raju M., Rolando A.M., Salley J.P., Yamin T.-T., Lee T.D., Shively J.E., McCross M., Mumford R.A., Schmidt J.A., Tocci M.J.Nature 356:768-774 (1992)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

ZNF391 (NM_001076781) Human Over-expression Lysate
LY421364 100 µg

ZNF391 (NM_001076781) Human Over-expression Lysate

Ask
View Details
Cytotoxic T-Lymphocyte Associated Antigen-4/ Fc Chimera Human Recombinant (CTLA 4 Human)
PT_74461-01 5 µg

Cytotoxic T-Lymphocyte Associated Antigen-4/ Fc Chimera Human Recombinant (CTLA 4 Human)

Ask
View Details
Cytotoxic T-Lymphocyte Associated Antigen-4/ Fc Chimera Human Recombinant (CTLA 4 Human)
PT_74461-02 25 µg

Cytotoxic T-Lymphocyte Associated Antigen-4/ Fc Chimera Human Recombinant (CTLA 4 Human)

Ask
View Details
Cytotoxic T-Lymphocyte Associated Antigen-4/ Fc Chimera Human Recombinant (CTLA 4 Human)
PT_74461-03 1 mg

Cytotoxic T-Lymphocyte Associated Antigen-4/ Fc Chimera Human Recombinant (CTLA 4 Human)

Ask
View Details
Zfp879 (NM_173387) Mouse Tagged ORF Clone
MR221177 10 µg

Zfp879 (NM_173387) Mouse Tagged ORF Clone

Ask
View Details
Angiopoietin-2, Mouse (HEK293, His)
HY-P72830 50 µg

Angiopoietin-2, Mouse (HEK293, His)

Ask
View Details