Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Angiopoietin-2, Mouse (HEK293, His)

Angiopoietin 2 protein (ANGPT2) binds to TEK/TIE2, competes with ANGPT1, and modulates its signaling. Even in the absence of ANGPT1, ANGPT2 induces TEK/TIE2 phosphorylation. Angiopoietin-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Angiopoietin-2 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

Angiopoietin-2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/angiopoietin-2-protein-mouse-hek293-his.html

Purity

96.10

Smiles

KEEQTTFRDCAEIFKSGLTTSGIYTLTFPNSTEEIKAYCDMDVGGGGWTVIQHREDGSVDFQRTWKEYKEGFGSPLGEYWLGNEFVSQLTGQHRYVLKIQLKDWEGNEAHSLYDHFYLAGEESNYRIHLTGLTGTAGKISSISQPGSDFSTKDSDNDKCICKCSQMLSGGWWFDACGPSNLNGQYYPQKQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF

Molecular Formula

11601 (Gene_ID) O35608 (K275-F496) (Accession)

Molecular Weight

Approximately 33.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

BDM_92499
MF-0114922-01 10 mg

BDM_92499

Sign In for Pricing
View Details
BDM_92499
MF-0114922-02 50 mg

BDM_92499

Sign In for Pricing
View Details
Polyclonal STK17A antibody - C-terminal region
APR01894G 0.05mg

Polyclonal STK17A antibody - C-terminal region

Sign In for Pricing
View Details
Tert-Butyl N- ({3-formylbicyclo[1.1.1]pentan-1-yl}methyl) carbamate
HY-W063708 1 Each

Tert-Butyl N- ({3-formylbicyclo[1.1.1]pentan-1-yl}methyl) carbamate

Sign In for Pricing
View Details
PIGQ (Phosphatidylinositol N-acetylglucosaminyltransferase Subunit Q, N-acetylglucosamyl Transferase Component GPI1, Phosphatidylinositol-glycan Biosynthesis Class Q Protein, PIG-Q, GPI1, c407A10.1, hGPI1, MGC12693) (MaxLight 750) discontinued
131328-ML750 100 µL

PIGQ (Phosphatidylinositol N-acetylglucosaminyltransferase Subunit Q, N-acetylglucosamyl Transferase Component GPI1, Phosphatidylinositol-glycan Biosynthesis Class Q Protein, PIG-Q, GPI1, c407A10.1, hGPI1, MGC12693) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal ZNF622 Antibody [DyLight 488]
NBP2-32103G 0.1 mL

Rabbit Polyclonal ZNF622 Antibody [DyLight 488]

Sign In for Pricing
View Details