Angiopoietin-2, Mouse (HEK293, His)
Angiopoietin 2 protein (ANGPT2) binds to TEK/TIE2, competes with ANGPT1, and modulates its signaling. Even in the absence of ANGPT1, ANGPT2 induces TEK/TIE2 phosphorylation. Angiopoietin-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Angiopoietin-2 protein, expressed by HEK293 , with N-His labeled tag.
Product Specifications
Product Name Alternative
Angiopoietin-2 Protein, Mouse (HEK293, His), Mouse, HEK293
UNSPSC
12352202
Type
Recombinant Proteins
Assay Protocol
https://www.medchemexpress.com/cytokines/angiopoietin-2-protein-mouse-hek293-his.html
Purity
96.10
Smiles
KEEQTTFRDCAEIFKSGLTTSGIYTLTFPNSTEEIKAYCDMDVGGGGWTVIQHREDGSVDFQRTWKEYKEGFGSPLGEYWLGNEFVSQLTGQHRYVLKIQLKDWEGNEAHSLYDHFYLAGEESNYRIHLTGLTGTAGKISSISQPGSDFSTKDSDNDKCICKCSQMLSGGWWFDACGPSNLNGQYYPQKQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF
Molecular Formula
11601 (Gene_ID) O35608 (K275-F496) (Accession)
Molecular Weight
Approximately 33.4 kDa
Shipping Conditions
Room temperature in continental US; may vary elsewhere.
Storage Conditions
Stored at -20°C for 2 years
Scientific Category
Recombinant Proteins
More Discoveries
Explore Other Products
Browse additional items from our catalog
40813141 1x 10^6 Cells / 1.0 mL
RPL13AP17 CRISPR Knock Out 293T Cell Line (Human)
Sign In for Pricing
View Details NBP2-98969AF405 0.1 mL
Rabbit Polyclonal Histone Deacetylase 8/HDAC8 Antibody [Alexa Fluor 405]
Sign In for Pricing
View Details MBS8558272-01 0.1 mL
Pyruvate Kinase (PKM2) (C-Term N491) Rabbit pAb
Sign In for Pricing
View Details MBS8558272-02 0.1 mL (AF405L)
Pyruvate Kinase (PKM2) (C-Term N491) Rabbit pAb
Sign In for Pricing
View Details