Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Angiopoietin-2, Mouse (HEK293, His)

Angiopoietin 2 protein (ANGPT2) binds to TEK/TIE2, competes with ANGPT1, and modulates its signaling. Even in the absence of ANGPT1, ANGPT2 induces TEK/TIE2 phosphorylation. Angiopoietin-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Angiopoietin-2 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

Angiopoietin-2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/angiopoietin-2-protein-mouse-hek293-his.html

Purity

96.10

Smiles

KEEQTTFRDCAEIFKSGLTTSGIYTLTFPNSTEEIKAYCDMDVGGGGWTVIQHREDGSVDFQRTWKEYKEGFGSPLGEYWLGNEFVSQLTGQHRYVLKIQLKDWEGNEAHSLYDHFYLAGEESNYRIHLTGLTGTAGKISSISQPGSDFSTKDSDNDKCICKCSQMLSGGWWFDACGPSNLNGQYYPQKQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF

Molecular Formula

11601 (Gene_ID) O35608 (K275-F496) (Accession)

Molecular Weight

Approximately 33.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Lipopolysaccharide Binding Protein (LBP) ELISA Kit
abx363128-01 96 Tests

Rabbit Lipopolysaccharide Binding Protein (LBP) ELISA Kit

Sign In for Pricing
View Details
Rabbit Lipopolysaccharide Binding Protein (LBP) ELISA Kit
abx363128-02 5x 96 Tests

Rabbit Lipopolysaccharide Binding Protein (LBP) ELISA Kit

Sign In for Pricing
View Details
Rabbit Lipopolysaccharide Binding Protein (LBP) ELISA Kit
abx363128-03 10x 96 Tests

Rabbit Lipopolysaccharide Binding Protein (LBP) ELISA Kit

Sign In for Pricing
View Details
Eg5 Antibody
N0776-01 40 µL

Eg5 Antibody

Sign In for Pricing
View Details
Eg5 Antibody
N0776-02 100 µL

Eg5 Antibody

Sign In for Pricing
View Details
Eg5 Antibody
N0776-03 200 µL

Eg5 Antibody

Sign In for Pricing
View Details