Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Angiopoietin-2, Mouse (HEK293, His)

Angiopoietin 2 protein (ANGPT2) binds to TEK/TIE2, competes with ANGPT1, and modulates its signaling. Even in the absence of ANGPT1, ANGPT2 induces TEK/TIE2 phosphorylation. Angiopoietin-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Angiopoietin-2 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

Angiopoietin-2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/angiopoietin-2-protein-mouse-hek293-his.html

Purity

96.10

Smiles

KEEQTTFRDCAEIFKSGLTTSGIYTLTFPNSTEEIKAYCDMDVGGGGWTVIQHREDGSVDFQRTWKEYKEGFGSPLGEYWLGNEFVSQLTGQHRYVLKIQLKDWEGNEAHSLYDHFYLAGEESNYRIHLTGLTGTAGKISSISQPGSDFSTKDSDNDKCICKCSQMLSGGWWFDACGPSNLNGQYYPQKQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF

Molecular Formula

11601 (Gene_ID) O35608 (K275-F496) (Accession)

Molecular Weight

Approximately 33.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRAV20 3'UTR Lenti-reporter-Luc Vector
47552081 1.0 µg

TRAV20 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
TREX1 Rabbit Monoclonal Antibody
AMRe85166-01 1 Each

TREX1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
TREX1 Rabbit Monoclonal Antibody
AMRe85166-02 50 µL

TREX1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
TREX1 Rabbit Monoclonal Antibody
AMRe85166-03 100 µL

TREX1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Onecut1 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6786404 1.0 µg DNA

Onecut1 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Human APOBEC1 complementation factor (A1CF) Elisa Kit
EK714572 96 Well

Human APOBEC1 complementation factor (A1CF) Elisa Kit

Sign In for Pricing
View Details