Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Angiopoietin-2, Mouse (HEK293, His)

Angiopoietin 2 protein (ANGPT2) binds to TEK/TIE2, competes with ANGPT1, and modulates its signaling. Even in the absence of ANGPT1, ANGPT2 induces TEK/TIE2 phosphorylation. Angiopoietin-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Angiopoietin-2 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

Angiopoietin-2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/angiopoietin-2-protein-mouse-hek293-his.html

Purity

96.10

Smiles

KEEQTTFRDCAEIFKSGLTTSGIYTLTFPNSTEEIKAYCDMDVGGGGWTVIQHREDGSVDFQRTWKEYKEGFGSPLGEYWLGNEFVSQLTGQHRYVLKIQLKDWEGNEAHSLYDHFYLAGEESNYRIHLTGLTGTAGKISSISQPGSDFSTKDSDNDKCICKCSQMLSGGWWFDACGPSNLNGQYYPQKQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF

Molecular Formula

11601 (Gene_ID) O35608 (K275-F496) (Accession)

Molecular Weight

Approximately 33.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

Diethyl 2-Acetamido-2-(2-formylethyl) Malonate
TRC-D443120-1G 1 g

Diethyl 2-Acetamido-2-(2-formylethyl) Malonate

Sign In for Pricing
View Details
alpha Actin antibody (smooth muscle)
10R-7941 100 ug

alpha Actin antibody (smooth muscle)

Sign In for Pricing
View Details
Annexin V-HF555/SYTOX Green Apoptosis Kit
K2261-50 50 Assays

Annexin V-HF555/SYTOX Green Apoptosis Kit

Sign In for Pricing
View Details
Rabbit anti-CD222 Antibody
YLD1448-01 50 µL

Rabbit anti-CD222 Antibody

Sign In for Pricing
View Details
Rabbit anti-CD222 Antibody
YLD1448-02 100 µL

Rabbit anti-CD222 Antibody

Sign In for Pricing
View Details
Human CARKD knockdown cell line
ABC-KD2365 1 Vial

Human CARKD knockdown cell line

Sign In for Pricing
View Details