Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Angiopoietin-2, Mouse (HEK293, His)

Angiopoietin 2 protein (ANGPT2) binds to TEK/TIE2, competes with ANGPT1, and modulates its signaling. Even in the absence of ANGPT1, ANGPT2 induces TEK/TIE2 phosphorylation. Angiopoietin-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Angiopoietin-2 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

Angiopoietin-2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/angiopoietin-2-protein-mouse-hek293-his.html

Purity

96.10

Smiles

KEEQTTFRDCAEIFKSGLTTSGIYTLTFPNSTEEIKAYCDMDVGGGGWTVIQHREDGSVDFQRTWKEYKEGFGSPLGEYWLGNEFVSQLTGQHRYVLKIQLKDWEGNEAHSLYDHFYLAGEESNYRIHLTGLTGTAGKISSISQPGSDFSTKDSDNDKCICKCSQMLSGGWWFDACGPSNLNGQYYPQKQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF

Molecular Formula

11601 (Gene_ID) O35608 (K275-F496) (Accession)

Molecular Weight

Approximately 33.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

OOEP Human shRNA Plasmid Kit (Locus ID 441161)
TR320915 1 Kit

OOEP Human shRNA Plasmid Kit (Locus ID 441161)

Sign In for Pricing
View Details
Anti-EDNRA Polyclonal Antibody
HB817024-01 50 µg

Anti-EDNRA Polyclonal Antibody

Sign In for Pricing
View Details
Anti-EDNRA Polyclonal Antibody
HB817024-02 100 µg

Anti-EDNRA Polyclonal Antibody

Sign In for Pricing
View Details
MECR (54-373, His-tag) Human Protein
AR09544PU-N 50 µg

MECR (54-373, His-tag) Human Protein

Sign In for Pricing
View Details
FAM72B (NM_001100910) Human Over-expression Lysate
LH05475V 100 µg

FAM72B (NM_001100910) Human Over-expression Lysate

Sign In for Pricing
View Details
pDNR-LIB-C6orf118 Plasmid
PVT28019 2 µg

pDNR-LIB-C6orf118 Plasmid

Sign In for Pricing
View Details