Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Angiopoietin-2, Mouse (HEK293, His)

Angiopoietin 2 protein (ANGPT2) binds to TEK/TIE2, competes with ANGPT1, and modulates its signaling. Even in the absence of ANGPT1, ANGPT2 induces TEK/TIE2 phosphorylation. Angiopoietin-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Angiopoietin-2 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

Angiopoietin-2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/angiopoietin-2-protein-mouse-hek293-his.html

Purity

96.10

Smiles

KEEQTTFRDCAEIFKSGLTTSGIYTLTFPNSTEEIKAYCDMDVGGGGWTVIQHREDGSVDFQRTWKEYKEGFGSPLGEYWLGNEFVSQLTGQHRYVLKIQLKDWEGNEAHSLYDHFYLAGEESNYRIHLTGLTGTAGKISSISQPGSDFSTKDSDNDKCICKCSQMLSGGWWFDACGPSNLNGQYYPQKQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF

Molecular Formula

11601 (Gene_ID) O35608 (K275-F496) (Accession)

Molecular Weight

Approximately 33.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

AURORA-A Kinase Antibody (Biotin)
GWB-Q00804 0.1 mg

AURORA-A Kinase Antibody (Biotin)

Sign In for Pricing
View Details
C3orf49 Polyclonal Antibody, Biotin Conjugated
bs-9831R-Biotin 100 µL

C3orf49 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
Easypro Human Thrombin Activatable Fibrinolysis Inhibitor (TAFI) ELISA Kit
FY-EH2238S 96 Well

Easypro Human Thrombin Activatable Fibrinolysis Inhibitor (TAFI) ELISA Kit

Sign In for Pricing
View Details
KRT6A (Keratin, Type II Cytoskeletal 6A, Keratin 6A)
484515 100 µL

KRT6A (Keratin, Type II Cytoskeletal 6A, Keratin 6A)

Sign In for Pricing
View Details
Fmoc-VAP-MMAE
MBS5824032 Inquire

Fmoc-VAP-MMAE

Sign In for Pricing
View Details
pENTR223-SUMO2 Plasmid
PVT12374 2 µg

pENTR223-SUMO2 Plasmid

Sign In for Pricing
View Details