Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Angiopoietin-2, Mouse (HEK293, His)

Angiopoietin 2 protein (ANGPT2) binds to TEK/TIE2, competes with ANGPT1, and modulates its signaling. Even in the absence of ANGPT1, ANGPT2 induces TEK/TIE2 phosphorylation. Angiopoietin-2 Protein, Mouse (HEK293, His) is the recombinant mouse-derived Angiopoietin-2 protein, expressed by HEK293 , with N-His labeled tag.

Product Specifications

Product Name Alternative

Angiopoietin-2 Protein, Mouse (HEK293, His), Mouse, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/angiopoietin-2-protein-mouse-hek293-his.html

Purity

96.10

Smiles

KEEQTTFRDCAEIFKSGLTTSGIYTLTFPNSTEEIKAYCDMDVGGGGWTVIQHREDGSVDFQRTWKEYKEGFGSPLGEYWLGNEFVSQLTGQHRYVLKIQLKDWEGNEAHSLYDHFYLAGEESNYRIHLTGLTGTAGKISSISQPGSDFSTKDSDNDKCICKCSQMLSGGWWFDACGPSNLNGQYYPQKQNTNKFNGIKWYYWKGSGYSLKATTMMIRPADF

Molecular Formula

11601 (Gene_ID) O35608 (K275-F496) (Accession)

Molecular Weight

Approximately 33.4 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

More Discoveries

Explore Other Products

Browse additional items from our catalog

RET Adenovirus (Rat)
38830057 1.0 mL

RET Adenovirus (Rat)

Sign In for Pricing
View Details
RAB2A Protein Lysate (Human) with C-Ha Tag
38318031 100 µg

RAB2A Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
PSIP1 Lentiviral Activation Particles (m)
sc-430394-LAC 200 µL

PSIP1 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
CBX4, NT (E3 SUMO-protein Ligase CBX4, Chromobox Protein Homolog 4, Polycomb 2 Homolog, Pc2, hPc2) (MaxLight 650) discontinued
C2098-79B-ML650 100 µL

CBX4, NT (E3 SUMO-protein Ligase CBX4, Chromobox Protein Homolog 4, Polycomb 2 Homolog, Pc2, hPc2) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Rabbit Anti-GATAD1 antibody
SL11921R-01 50 µL

Rabbit Anti-GATAD1 antibody

Sign In for Pricing
View Details
Rabbit Anti-GATAD1 antibody
SL11921R-02 100 µL

Rabbit Anti-GATAD1 antibody

Sign In for Pricing
View Details