Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Hemopexin, Human (HEK293, His, solution)

Hemopexin Protein efficiently binds and transports heme to the liver for degradation, recovering iron. After this essential process, Hemopexin seamlessly re-enters circulation. It also interacts with FLVCR1, playing a multifaceted role in heme metabolism and iron homeostasis. Hemopexin Protein, Human (HEK293, His, solution) is the recombinant human-derived Hemopexin protein, expressed by HEK293 , with C-6*His labeled tag.

Product Specifications

Product Name Alternative

Hemopexin Protein, Human (HEK293, His, solution), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/hemopexin-protein-human-hek-293-his.html

Purity

99.90

Smiles

TPLPPTSAHGNVAEGETKPDPDVTERCSDGWSFDATTLDDNGTMLFFKGEFVWKSHKWDRELISERWKNFPSPVDAAFRQGHNSVFLIKGDKVWVYPPEKKEKGYPKLLQDEFPGIPSPLDAAVECHRGECQAEGVLFFQGDREWFWDLATGTMKERSWPAVGNCSSALRWLGRYYCFQGNQFLRFDPVRGEVPPRYPRDVRDYFMPCPGRGHGHRNGTGHGNSTHHGPEYMRCSPHLVLSALTSDNHGATYAFSGTHYWRLDTSRDGWHSWPIAHQWPQGPSAVDAAFSWEEKLYLVQGTQVYVFLTKGGYTLVSGYPKRLEKEVGTPHGIILDSVDAAFICPGSSRLHIMAGRRLWWLDLKSGAQATWTELPWPHEKVDGALCMEKSLGPNSCSANGPGLYLIHGPNLYCYSDVEKLNAAKALPQPQNVTSLLGCTH

Molecular Formula

3263 (Gene_ID) P02790 (T24-H462) (Accession)

Molecular Weight

60-90 kDa

Shipping Conditions

Dry ice.

Storage Conditions

Stored at -80°C for 1 year

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IL3RA Human shRNA Lentiviral Particle (Locus ID 3563)
TL312166V 500 µL Each

IL3RA Human shRNA Lentiviral Particle (Locus ID 3563)

Sign In for Pricing
View Details
GENLISA™ Human Calprotectin (CALPRO) ELISA
KBH4010 1x 96 Well

GENLISA™ Human Calprotectin (CALPRO) ELISA

Sign In for Pricing
View Details
SOX10 Monoclonal Antibody
ELAB6728-R-01 0.1 mL

SOX10 Monoclonal Antibody

Sign In for Pricing
View Details
SOX10 Monoclonal Antibody
ELAB6728-R-02 0.2 mL

SOX10 Monoclonal Antibody

Sign In for Pricing
View Details
SOX10 Monoclonal Antibody
ELAB6728-R-03 1 mL

SOX10 Monoclonal Antibody

Sign In for Pricing
View Details
Anti-MPXV A35R Human IgG ELISA Kit
AK601028 96 Tests

Anti-MPXV A35R Human IgG ELISA Kit

Sign In for Pricing
View Details