Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MIF, Human (His)

The MIF protein is a pro-inflammatory cytokine that is critical for the innate immune response against bacterial pathogens. Its presence at sites of inflammation suggests a role in modulating macrophage function to promote host defense. MIF Protein, Human (His) is the recombinant human-derived MIF protein, expressed by E. coli , with N-6*His labeled tag.

Product Specifications

Product Name Alternative

MIF Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/mif-protein-human-n-his.html

Purity

95.0

Smiles

MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA

Molecular Formula

4282 (Gene_ID) P14174 (M1-A115) (Accession)

Molecular Weight

Approximately 11.67 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recoverin (RCVRN) Human Gene Knockout Kit (CRISPR)
KN400428 1 Kit

Recoverin (RCVRN) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Talquetamab Biosimilar - Research Grade
ICH5207-50mg 50 mg

Talquetamab Biosimilar - Research Grade

Sign In for Pricing
View Details
TGF beta Receptor III (TGFBR3) Human Gene Knockout Kit (CRISPR)
KN416595 1 Kit

TGF beta Receptor III (TGFBR3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CDPI3 Succinimidyl Ester [Minor Groove Binder SE]
6907-AAT 1 mg

CDPI3 Succinimidyl Ester [Minor Groove Binder SE]

Sign In for Pricing
View Details
Purified Anti-Human CD11a Antibody[HI111]
E-AB-F1316A-01 25 µg

Purified Anti-Human CD11a Antibody[HI111]

Sign In for Pricing
View Details
Purified Anti-Human CD11a Antibody[HI111]
E-AB-F1316A-02 100 µg

Purified Anti-Human CD11a Antibody[HI111]

Sign In for Pricing
View Details