Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DODA Recombinant Protein (Rose moss)

Product Specifications

CAS Number

9000-83-3

Gene Aliases

DODA4,5-DOPA dioxygenase extradiol, EC 1.13.11.29

Reactivity

Portulaca grandiflora

Target

Opens the cyclic ring of dihydroxy-phenylalanine (DOPA) between carbons 4 and 5, thus producing an unstable seco-DOPA that rearranges nonenzymatically to betalamic acid.

Type

Protein

Source

E.coli

Sequence

MGVGKEVSFKESFFLSHGNPAMLADESFIARNFLLGWKKNVFPVKPKSILVVSAHWETDVPCVSAGQYPNVIYDFTEVPASMFQMKYPAPGCPKLAKRVQELLIAGGFKSAKLDEERGFDHSSWVPLSMMCPEADIPVCQLSVQPGLDATHHFNVGRALAPLKGEGVLFIGSGGAVHPSDDTPHWFDGVAPWAAEFDQWLEDALLEGRYEDVNNYQTKAPEGWKLAHPIPEHFLPLHVAMGAGGEKSKAELIYRTWDHGTLGYASYKFTSI

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

49.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

DODA

Protein Name

4,5-DOPA dioxygenase extradiol

Gene Name URL

DODA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STAT5A, CT (Mgf, Mpf, Signal Transducer And Activator of Transcription 5A)
397196 100 µg

STAT5A, CT (Mgf, Mpf, Signal Transducer And Activator of Transcription 5A)

Sign In for Pricing
View Details
MRGPRG Adenovirus (Mouse)
30416054 1.0 mL

MRGPRG Adenovirus (Mouse)

Sign In for Pricing
View Details
Recombinant Human PURA Protein, N-His
YHF82501 100 μg

Recombinant Human PURA Protein, N-His

Sign In for Pricing
View Details
Tlr6 Rabbit Polyclonal Antibody
orb865574 100 µg

Tlr6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Lentiviral mouse Rev1 shRNA (UAS) - Lentiviral mouse Rev1 shRNA (UAS) (25)
GTR15164969 1 Vial

Lentiviral mouse Rev1 shRNA (UAS) - Lentiviral mouse Rev1 shRNA (UAS) (25)

Sign In for Pricing
View Details
C21orf66 Rabbit Polyclonal Antibody (HRP)
orb2115398 100 µL

C21orf66 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details