Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C21orf66 Rabbit Polyclonal Antibody (HRP)

C21orf66 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

GCFC, BM020, GCFC1, FSAP105, C21orf66

UniProt

Q9Y5B6

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human C21orf66

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PGEIPDAAFIHAARKKRQMARELGDFTPHDNEPGKGRLVREDENDASDDE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

93kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_037461

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit BNP (Brain Natriuretic Peptide) ValidElisa Kit
EK347240 96 Well

Rabbit BNP (Brain Natriuretic Peptide) ValidElisa Kit

Sign In for Pricing
View Details
Recombinant Saccharomyces Cerevisiae ARG1 Protein (aa 1-420) [His]
VAng-Wyb4220-1mg 1 mg

Recombinant Saccharomyces Cerevisiae ARG1 Protein (aa 1-420) [His]

Sign In for Pricing
View Details
Pdcl2 3'UTR GFP Stable Cell Line
TU166092 1.0 mL

Pdcl2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Cryptococcus neoformans var. neoformans serotype D Mitochondrial import inner membrane translocase subunit TIM8 (TIM8)
MBS1207655-01 0.02 mg (E-Coli)

Recombinant Cryptococcus neoformans var. neoformans serotype D Mitochondrial import inner membrane translocase subunit TIM8 (TIM8)

Sign In for Pricing
View Details
Recombinant Cryptococcus neoformans var. neoformans serotype D Mitochondrial import inner membrane translocase subunit TIM8 (TIM8)
MBS1207655-02 0.1 mg (E-Coli)

Recombinant Cryptococcus neoformans var. neoformans serotype D Mitochondrial import inner membrane translocase subunit TIM8 (TIM8)

Sign In for Pricing
View Details
Recombinant Cryptococcus neoformans var. neoformans serotype D Mitochondrial import inner membrane translocase subunit TIM8 (TIM8)
MBS1207655-03 0.02 mg (Yeast)

Recombinant Cryptococcus neoformans var. neoformans serotype D Mitochondrial import inner membrane translocase subunit TIM8 (TIM8)

Sign In for Pricing
View Details