Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMM23 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Translocase of inner mitochondrial membrane 23

Gene Aliases

Mitochondrial import inner membrane translocase subunit Tim23; TIM23; translocase of inner mitochondrial membrane 23 homolog; translocase of the inner mitochondrial membrane.

Gene ID

100287932

Accession Number

NP_006318

Reactivity

Homo sapiens|Human

Target

Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane.

Type

Protein

Source

E.coli

Sequence

MEGGGGSGNKTTGGLAGFFGAGGAGYSHADLAGVPLTGMNPLSPYLNVDPRYLVQDTDEFILPTGANKTRGRFELAFFTIGGCCMTGAAFGAMNGLRLGLKETQNMAWSKPRNVQILNMVTRQGALWANTLGSLALLYSAFGVIIEKTRGAEDDLNTVAAGTMTGMLYKCTGGLRGIARGGLTGLTLTSLYALYNNWEHMKGSLLQQSL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

48.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TIMM23

Protein Name

Mitochondrial import inner membrane translocase subunit Tim23

Gene Name URL

TIMM23

Nucleotide Accession Number

NM_006327

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

QRICH1 (AK074313) Human Untagged Clone
SC314671 10 µg

QRICH1 (AK074313) Human Untagged Clone

Sign In for Pricing
View Details
LOC685105 3'UTR GFP Stable Cell Line
TU261182 1.0 mL

LOC685105 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Mouse Monoclonal Von Hippel Lindau Antibody (AT82B10) [Alexa Fluor 350]
NBP1-04355AF350 0.1 mL

Mouse Monoclonal Von Hippel Lindau Antibody (AT82B10) [Alexa Fluor 350]

Sign In for Pricing
View Details
Boc-D-Lys (N3) -OH
HY-151703 1 Each

Boc-D-Lys (N3) -OH

Sign In for Pricing
View Details
C1QB (Complement Component 1, q Subcomponent, B Chain) (MaxLight 550)
MBS6409079-01 0.1 mL

C1QB (Complement Component 1, q Subcomponent, B Chain) (MaxLight 550)

Sign In for Pricing
View Details
C1QB (Complement Component 1, q Subcomponent, B Chain) (MaxLight 550)
MBS6409079-02 5x 0.1 mL

C1QB (Complement Component 1, q Subcomponent, B Chain) (MaxLight 550)

Sign In for Pricing
View Details