Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GRPEL1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

GrpE like 1, mitochondrial

Gene Aliases

GrpE; grpE protein homolog 1, mitochondrial; GrpE-like protein cochaperone; HMGE; mt-GrpE#1.

Gene ID

80273

Accession Number

NP_079472

Reactivity

Homo sapiens|Human

Target

Essential component of the PAM complex, a complex required for the translocation of transit peptide-containing proteins from the inner membrane into the mitochondrial matrix in an ATP-dependent manner (By similarity) . Seems to control the nucleotide-dependent binding of mitochondrial HSP70 to substrate proteins (PubMed:11311562) .

Type

Protein

Source

E.coli

Sequence

CTATKQKNSGQNLEEDMGQSEQKADPPATEKTLLEEKVKLEEQLKETVEKYKRALADTENLRQRSQKLVEEAKLYGIQAFCKDLLEVADVLEKATQCVPKEEIKDDNPHLKNLYEGLVMTEVQIQKVFTKHGLLKLNPVGAKFDPYEHEALFHTPVEGKEPGTVALVSKVGYKLHGRTLRPALVGVVKEA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

48.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

GRPEL1

Protein Name

GrpE protein homolog 1, mitochondrial

Gene Name URL

GRPEL1

Nucleotide Accession Number

NM_025196

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Joint
CS701780 5x 5 µm

Tissue FFPE Sections, Joint

Sign In for Pricing
View Details
MEK kinase-2 Lentiviral Activation Particles (m)
sc-424040-LAC 200 µL

MEK kinase-2 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
4E-BP1 (phospho Thr46) rabbit pAb
ES5077-01 50 µL

4E-BP1 (phospho Thr46) rabbit pAb

Sign In for Pricing
View Details
4E-BP1 (phospho Thr46) rabbit pAb
ES5077-02 100 µL

4E-BP1 (phospho Thr46) rabbit pAb

Sign In for Pricing
View Details
Retort Ring, With Die Cast Boss Head, Zinc 100mm
2073480/A 1 Each

Retort Ring, With Die Cast Boss Head, Zinc 100mm

Sign In for Pricing
View Details
Human ZMAT5 (NM_019103) AAV Particle
RC202215A1V 250 µL

Human ZMAT5 (NM_019103) AAV Particle

Sign In for Pricing
View Details