Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHLDA2 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Pleckstrin homology like domain family A member 2

Gene Aliases

Beckwith-Wiedemann syndrome chromosomal region 1 candidate gene C protein; BRW1C; BWR1C; HLDA2; imprinted in placenta and liver protein; IPL; p17-Beckwith-Wiedemann region 1 C; p17-Beckwith-Wiedemann region 1C; p17-BWR1C; pleckstrin homology-like domain family A member 2; TSSC3; tumor suppressing subchromosomal transferable fragment cDNA 3; tumor suppressing subtransferable candidate 3; Tumor-suppressing STF cDNA 3 protein; tumor-suppressing subchromosomal transferable fragment candidate gene 3 protein; tumor-supressing STF cDNA 3.

Gene ID

7262

Accession Number

NP_003302

Reactivity

Homo sapiens|Human

Target

Plays a role in regulating placenta growth. May act via its PH domain that competes with other PH domain-containing proteins, thereby preventing their binding to membrane lipids (By similarity) .

Type

Protein

Source

E.coli

Sequence

MKSPDEVLREGELEKRSDSLFQLWKKKRGVLTSDRLSLFPASPRARPKELRFHSILKVDCVERTGKYVYFTIVTTDHKEIDFRCAGESCWNAAIALALIDFQNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRTP

Purification

Affinity purified using AC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Reconstitution

-20°C or -80°C

Molecular Weight

44.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PHLDA2

Protein Name

Pleckstrin homology-like domain family A member 2

Gene Name URL

PHLDA2

Nucleotide Accession Number

NM_003311

More Discoveries

Explore Other Products

Browse additional items from our catalog

Coltsfoot Extract
E3397-5mg 5 mg

Coltsfoot Extract

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O157:H7 LAPB Polyclonal Antibody
MBS7163341 Inquire

Rabbit anti-Escherichia coli O157:H7 LAPB Polyclonal Antibody

Sign In for Pricing
View Details
PACSIN2 Rabbit Polyclonal Antibody (Fluoro594)
orb3106176 100 µg

PACSIN2 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
Hayflick Agar Base
ME1886-500G 500 g

Hayflick Agar Base

Sign In for Pricing
View Details
DARS Peptide - C-terminal region
orb2003442 100 µg

DARS Peptide - C-terminal region

Sign In for Pricing
View Details
Procalcitonin (PCT) BioAssayTM ELISA Kit (Human)
351687-01 48 Tests

Procalcitonin (PCT) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details