DARS Peptide - C-terminal region
DARS Peptide - C-terminal region
Product Specifications
UniProt
P14868
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DARS Rabbit Polyclonal Antibody (orb587935) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001340
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LAVRPFYTMPDPRNPKQSNSYDMFMRGEEILSGAQRIHDPQLLTERALHH
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1183099 Inquire
Recombinant Streptococcus pneumoniae serotype 19F ATP synthase subunit a (atpB)
Sign In for Pricing
View Details 
IRTIGMKICRTK2118CPE200 200 Tests
Rat IgM Kappa Isotype Control Monoclonal Clone RTK2118 PE Ready To Use 200 Tests
Sign In for Pricing
View Details