Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CAPZB Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Capping actin protein of muscle Z-line subunit beta

Gene Aliases

CAPB; CAPPB; capping actin protein of muscle Z-line beta subunit; capping protein (actin filament) muscle Z-line, beta; CAPZ; capZ beta; epididymis secretory sperm binding protein; F-actin-capping protein subunit beta.

Gene ID

832

Accession Number

NP_001193469

Reactivity

Homo sapiens|Human

Target

F-actin-capping proteins bind in a Ca (2+) -independent manner to the fast growing ends of actin filaments (barbed end) thereby blocking the exchange of subunits at these ends. Unlike other capping proteins (such as gelsolin and severin), these proteins do not sever actin filaments. Plays a role in the regulation of cell morphology and cytoskeletal organization.

Type

Protein

Source

E.coli

Sequence

MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYLLCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVYLWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTNKSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIVNGLRSVQTFADKSKQEALKNDLVEALKRKQQC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

57.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CAPZB

Protein Name

F-actin-capping protein subunit beta

Gene Name URL

CAPZB

Nucleotide Accession Number

NM_001206540

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat Asialoglycoprotein receptor 1 (Asgr1), partial
CSB-MP002207RA1-01 10 µg

Recombinant Rat Asialoglycoprotein receptor 1 (Asgr1), partial

Sign In for Pricing
View Details
Recombinant Rat Asialoglycoprotein receptor 1 (Asgr1), partial
CSB-MP002207RA1-02 50 µg

Recombinant Rat Asialoglycoprotein receptor 1 (Asgr1), partial

Sign In for Pricing
View Details
Recombinant Rat Asialoglycoprotein receptor 1 (Asgr1), partial
CSB-MP002207RA1-03 200 µg

Recombinant Rat Asialoglycoprotein receptor 1 (Asgr1), partial

Sign In for Pricing
View Details
Recombinant Rat Asialoglycoprotein receptor 1 (Asgr1), partial
CSB-MP002207RA1-04 500 µg

Recombinant Rat Asialoglycoprotein receptor 1 (Asgr1), partial

Sign In for Pricing
View Details
Recombinant Rat Asialoglycoprotein receptor 1 (Asgr1), partial
CSB-MP002207RA1-05 20 µg

Recombinant Rat Asialoglycoprotein receptor 1 (Asgr1), partial

Sign In for Pricing
View Details
Recombinant Rat Asialoglycoprotein receptor 1 (Asgr1), partial
CSB-MP002207RA1-06 100 µg

Recombinant Rat Asialoglycoprotein receptor 1 (Asgr1), partial

Sign In for Pricing
View Details