Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Asialoglycoprotein receptor 1 (Asgr1), partial

Product Specifications

Product Name Alternative

Hepatic lectin 1

Abbreviation

Recombinant Rat Asgr1 protein, partial

Gene Name

Asgr1

UniProt

P02706

Expression Region

61-284aa

Organism

Rattus norvegicus (Rat)

Target Sequence

QNSQLREDLRVLRQNFSNFTVSTEDQVKALTTQGERVGRKMKLVESQLEKHQEDLREDHSRLLLHVKQLVSDVRSLSCQMAALRGNGSERICCPINWVEYEGSCYWFSSSVKPWTEADKYCQLENAHLVVVTSWEEQRFVQQHMGPLNTWIGLTDQNGPWKWVDGTDYETGFKNWRPGQPDDWYGHGLGGGEDCAHFTTDGHWNDDVCRRPYRWVCETELGKAN

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Type

In Stock Protein

Source

Mammalian cell

Field of Research

Signal Transduction

Relevance

Mediates the endocytosis of plasma glycoproteins to which the terminal sialic acid residue on their complex carbohydrate moieties has been removed. The receptor recognizes terminal galactose and N-acetylgalactosamine units. After ligand binding to the receptor, the resulting complex is internalized and transported to a sorting organelle, where receptor and ligand are disassociated. The receptor then returns to the cell membrane surface.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

31 kDa

References & Citations

"Rat liver asialoglycoprotein receptor lacks a cleavable NH2-terminal signal sequence." Holland E.C., Leung J.O., Drickamer K. Proc. Natl. Acad. Sci. U.S.A. 81:7338-7342 (1984)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Product MSDS

https://www.cusabio.com/msds/12930014/

Protein Length

Partial

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Recombinant Human Secretogranin V Protein
NBP1-48343-0.05mg 0.05 mg

Recombinant Human Secretogranin V Protein

Ask
View Details
EPS8L1, NT (EPS8L1, DRC3, EPS8R1, Epidermal growth factor receptor kinase substrate 8-like protein 1, Epidermal growth factor receptor pathway substrate 8-related protein 1) (MaxLight 490)
MBS6296113-01 0.1 mL

EPS8L1, NT (EPS8L1, DRC3, EPS8R1, Epidermal growth factor receptor kinase substrate 8-like protein 1, Epidermal growth factor receptor pathway substrate 8-related protein 1) (MaxLight 490)

Ask
View Details
EPS8L1, NT (EPS8L1, DRC3, EPS8R1, Epidermal growth factor receptor kinase substrate 8-like protein 1, Epidermal growth factor receptor pathway substrate 8-related protein 1) (MaxLight 490)
MBS6296113-02 5x 0.1 mL

EPS8L1, NT (EPS8L1, DRC3, EPS8R1, Epidermal growth factor receptor kinase substrate 8-like protein 1, Epidermal growth factor receptor pathway substrate 8-related protein 1) (MaxLight 490)

Ask
View Details
Fam107b AAV siRNA Pooled Vector
19694166 1.0 μg

Fam107b AAV siRNA Pooled Vector

Ask
View Details
Mouse Trinucleotide repeat-containing gene 6A protein (TNRC6A) ELISA Kit
abx550735 96 Tests

Mouse Trinucleotide repeat-containing gene 6A protein (TNRC6A) ELISA Kit

Ask
View Details
Tributylamine 97%
T18445-01 500 mL

Tributylamine 97%

Ask
View Details